KEGG   Streptomyces hygroscopicus subsp. jinggangensis 5008: SHJG_8020Help
Entry
SHJG_8020         CDS       T02063                                 

Definition
D-cysteine desulfhydrase
Organism
shy  Streptomyces hygroscopicus subsp. jinggangensis 5008
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(9167535..9168509)
Genome map
AA seq 324 aa AA seqDB search
MTHPPVPLSTFPTPLEPAPRLAAALGLGPEDLWVKRDDLTGLGGGGNKIRKLEWTVGAAV
AEGADTLVTTGAPQSNHARLTAAAGARLGLDAVLVLRGTPGASRSGNLALDGLFGARLAW
AGEVDQAGLDAAAAEVCARLRSEGARPALIPFGGSGTLGARGYVRCGTELREQLPDLRTV
VVALGSGGTMAGLVAALGSGSVLGVDVGALADPAAAVAEFAAPLTAEAVTPDTLRIRRDQ
VGAGYATLTAPVREALRLAARTEGLVLDPIYTGRALAGLHAAVRDGTVRPGERTVFLHTG
GLPGLFGHTDTIAFAEEGARAFDV
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgacccacccgcccgtgccgctgagcaccttccccacccctctggaaccggcgccccgg
ctcgccgccgcgctcgggctcgggcccgaggacctgtgggtgaagcgggacgacctgacc
ggcctgggcggcggcggcaacaagatccgcaagctggagtggacggtgggcgcggccgtc
gccgagggcgccgacacgctcgtgaccaccggtgccccgcagagcaaccacgcccggctg
accgccgccgcgggcgcccggctcgggctggacgccgtcctcgtcctgcgcggcaccccg
ggcgcctcccgctccgggaacctcgccctggacggcctgttcggggcgcggctcgcctgg
gcgggcgaggtggaccaggccgggctggacgcggcggcggccgaggtctgcgcgcggctg
cggtccgagggcgcccgccccgcactgatcccgttcggcggctccggcacactgggcgcc
agggggtacgtacgctgcggcacggagctgcgcgagcaactgccggacctgcgtacggtg
gtcgtggccctcggctcgggcggcacgatggccgggctggtcgcggccctgggcagcggg
tcggtcctcggcgtcgacgtgggcgcgctggccgatccggccgcggcggtcgcggagttc
gccgcaccgctcacggcggaggcggtcacgccggacaccctgcggattcgccgggaccag
gtgggcgccggctacgcgaccctcaccgccccggtacgcgaagccctccgcctcgccgcc
cgcaccgagggcctggtcctcgaccccatctacaccggccgcgccctggccggcctgcac
gccgcggtccgcgacggcaccgtccgcccgggcgagcggacggtcttcctccacaccggc
ggcctcccggggctgttcggccacacggacacgatcgccttcgcggaggagggcgcgcgg
gccttcgacgtgtag

DBGET integrated database retrieval system