KEGG   Streptomyces hygroscopicus subsp. jinggangensis 5008: SHJG_8020Help
Entry
SHJG_8020         CDS       T02063                                 

Definition
(RefSeq) D-cysteine desulfhydrase
  KO
K05396  
D-cysteine desulfhydrase [EC:4.4.1.15]
Organism
shy  Streptomyces hygroscopicus subsp. jinggangensis 5008
Pathway
Cysteine and methionine metabolism
Brite
KEGG Orthology (KO) [BR:shy00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    SHJG_8020
Enzymes [BR:shy01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.15  D-cysteine desulfhydrase
     SHJG_8020
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(9167535..9168509)
Genome map
AA seq 324 aa AA seqDB search
MTHPPVPLSTFPTPLEPAPRLAAALGLGPEDLWVKRDDLTGLGGGGNKIRKLEWTVGAAV
AEGADTLVTTGAPQSNHARLTAAAGARLGLDAVLVLRGTPGASRSGNLALDGLFGARLAW
AGEVDQAGLDAAAAEVCARLRSEGARPALIPFGGSGTLGARGYVRCGTELREQLPDLRTV
VVALGSGGTMAGLVAALGSGSVLGVDVGALADPAAAVAEFAAPLTAEAVTPDTLRIRRDQ
VGAGYATLTAPVREALRLAARTEGLVLDPIYTGRALAGLHAAVRDGTVRPGERTVFLHTG
GLPGLFGHTDTIAFAEEGARAFDV
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgacccacccgcccgtgccgctgagcaccttccccacccctctggaaccggcgccccgg
ctcgccgccgcgctcgggctcgggcccgaggacctgtgggtgaagcgggacgacctgacc
ggcctgggcggcggcggcaacaagatccgcaagctggagtggacggtgggcgcggccgtc
gccgagggcgccgacacgctcgtgaccaccggtgccccgcagagcaaccacgcccggctg
accgccgccgcgggcgcccggctcgggctggacgccgtcctcgtcctgcgcggcaccccg
ggcgcctcccgctccgggaacctcgccctggacggcctgttcggggcgcggctcgcctgg
gcgggcgaggtggaccaggccgggctggacgcggcggcggccgaggtctgcgcgcggctg
cggtccgagggcgcccgccccgcactgatcccgttcggcggctccggcacactgggcgcc
agggggtacgtacgctgcggcacggagctgcgcgagcaactgccggacctgcgtacggtg
gtcgtggccctcggctcgggcggcacgatggccgggctggtcgcggccctgggcagcggg
tcggtcctcggcgtcgacgtgggcgcgctggccgatccggccgcggcggtcgcggagttc
gccgcaccgctcacggcggaggcggtcacgccggacaccctgcggattcgccgggaccag
gtgggcgccggctacgcgaccctcaccgccccggtacgcgaagccctccgcctcgccgcc
cgcaccgagggcctggtcctcgaccccatctacaccggccgcgccctggccggcctgcac
gccgcggtccgcgacggcaccgtccgcccgggcgagcggacggtcttcctccacaccggc
ggcctcccggggctgttcggccacacggacacgatcgccttcgcggaggagggcgcgcgg
gccttcgacgtgtag

DBGET integrated database retrieval system