KEGG   Streptomyces hygroscopicus subsp. jinggangensis 5008: SHJG_8482Help
Entry
SHJG_8482         CDS       T02063                                 

Definition
(GenBank) tryptophan synthase subunit beta
  KO
K06001  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
shy  Streptomyces hygroscopicus subsp. jinggangensis 5008
Pathway
shy00260  Glycine, serine and threonine metabolism
shy00400  Phenylalanine, tyrosine and tryptophan biosynthesis
shy01100  Metabolic pathways
shy01110  Biosynthesis of secondary metabolites
shy01130  Biosynthesis of antibiotics
shy01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:shy00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SHJG_8482
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SHJG_8482
Enzymes [BR:shy01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     SHJG_8482
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: AEY93747
UniProt: H2K818
Position
9712836..9714191
Genome map
AA seq 451 aa AA seqDB search
MSGGPRPAPGASTPGPDWNPTPVVPSGAPDDVPEAWFNLVPNLPVPLPPARDGDDGQPSR
LALQRRIRLAAVQEQDASTESFLPIPQRVREELAAIGRPTPLLRARALEAHLRTPARIYL
KREDVLPTGSFKLNSAIAQAYFAAQQGVRTLVTETGAGQWGHAVAWAARLFGLHAVIFWA
GVSARQKPGRHTVIKLLGGEVYPSPSERTQVGKALLRDGRHLLGSLGTAIGEAISYAQDH
PETRYISGSNLPHVLAHQSVIGQEVKAQLAALGETPDTLIACVGGGSNLGGLMGPYLADK
AERGDGLTLIGAESASAPRLTRGEWRYDHADPEGITPLTKSYTLGRDYELPETHVGGLRQ
HSGSAVVGVLRSQGLIDAVAYQEAEAFETGSLMLRHEGVLIAPESCHAVRAAVDRAIEAR
RTGRAETIVACVSGNGALDLEGYTAHLGDGA
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atgagcggcggaccgcggcccgcgccgggcgccagtaccccgggccccgactggaacccg
accccggtcgtgccgagcggtgccccggacgatgtgcccgaagcctggttcaacctcgta
cccaatctgccggtccccctgccgcctgccagggacggcgacgacggccagccctcccgg
ctcgcgctccagcgccggatccgcctcgccgcggtgcaggaacaggacgcgtccacggag
tccttccttcccatcccgcagcgggtccgcgaggaactcgcggccatcggccgccccacc
ccgctgctgcgggcacgggccctggaggctcaccttcggacgcctgcccggatctacctc
aagcgcgaggacgtgctgcccaccggcagcttcaagctcaactcggccatcgcacaggcg
tacttcgccgcacagcagggcgtacggacgctggtgaccgagaccggagcggggcagtgg
ggccacgcggtggcctgggcggcgcggctcttcggtctgcacgcggtgatcttctgggcc
ggcgtgtcggcgcggcagaagcccggcaggcacacggtgatcaagctgctcggcggcgag
gtgtacccgtcgcccagcgagcggacgcaggtcggcaaggcgctgctgcgcgacggccgc
catctgctgggctccctcggcacggccatcggcgaagccatcagctatgcgcaggaccac
cccgagacccggtacatctcgggcagcaacctgccccatgtgctggcgcaccagtccgtc
atcggacaggaggtcaaggctcagctcgcggcgctcggcgagaccccggacaccctgatc
gcctgtgtcggcggcggcagcaacctgggtggcctgatgggcccttacctggcggacaag
gccgagcgcggcgacggactgacgctgatcggcgccgagtcggccagcgcaccccggctg
acccgcggcgagtggcgctacgaccacgccgacccggagggcatcacgccgctgaccaag
tcctacaccctcggccgtgactacgagctgcccgagacccatgtcggcggcctgcgccag
cacagcggctcggcggtggtcggcgtgctgcgcagccagggcctgatcgacgcggtcgcc
taccaggaggcggaggcgttcgagaccggctcgctcatgctccgccacgagggcgtgctc
atcgcccccgagtcctgccacgcggtgcgcgccgccgtcgaccgggcgatcgaagcccgt
cgcacgggccgcgccgagaccatcgtcgcctgcgtgagcggcaacggtgccctcgacctg
gagggctacaccgcgcacctcggtgacggtgcctga

DBGET integrated database retrieval system