KEGG   Streptomyces hygroscopicus subsp. jinggangensis 5008: SHJG_8764Help
Entry
SHJG_8764         CDS       T02063                                 

Definition
(GenBank) branched-chain alpha-keto acid dehydrogenase subunit E2
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
shy  Streptomyces hygroscopicus subsp. jinggangensis 5008
Pathway
shy00010  Glycolysis / Gluconeogenesis
shy00020  Citrate cycle (TCA cycle)
shy00620  Pyruvate metabolism
shy01100  Metabolic pathways
shy01110  Biosynthesis of secondary metabolites
shy01120  Microbial metabolism in diverse environments
shy01130  Biosynthesis of antibiotics
shy01200  Carbon metabolism
Module
shy_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:shy00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SHJG_8764
   00020 Citrate cycle (TCA cycle)
    SHJG_8764
   00620 Pyruvate metabolism
    SHJG_8764
Enzymes [BR:shy01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     SHJG_8764
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh E3_binding Biotin_lipoyl
Motif
Other DBs
NCBI-ProteinID: AEY94028
UniProt: H2JP48
Position
complement(10016053..10017504)
Genome map
AA seq 483 aa AA seqDB search
MSPGDRVHKGDVVAVVETDKAAIEVECFESGTVGRLLVAPGARVPVGTPLAVIEGEAASG
VPAGAPGEPVTAGAGEPVGETHPQPTAARAKADREPAARQKSPQPRRKAAREPEHAPEPA
QAEPRKQPAGQHLQALPEPSAGTTSVIGTGPLVRHLAQHRGVDLTTLHGTGPGGRITRAD
VDRAAPLLTPGVRATPYARRLARDLGIDLAAVRGTGDGGAVRAADVHTAVRAGAGAERPG
RGPRGGEQRPHAAVAADSRPEDRTDAMRRAIADLMSRSKREIPHYYLSTNVDLTATEDWL
RRINRGRPPAGRLVPAALLLKAAALAAREVPTLNGYWRNNGFAPASEINLGVAVSLRQGG
LLAPVIHRADTLPLDALMARLKDLVQRARRGRLRGSETTAATLTVTNLGDQGVDAVFGVV
HPPQVALVGFGAVVERPWAANGMLGVRPVVTATLAADHRATDGAVGARYLTAVDRLLQQP
EEL
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
gtgagccccggtgaccgggtacacaagggcgacgtcgtggcggtcgtggagacggacaag
gctgctatcgaggtcgagtgcttcgagtccgggaccgtggggcggctgctcgttgcgccg
ggtgcccgggttccggtggggacgccgctcgcggtgatcgagggcgaagccgcctccggc
gtgccggcaggcgcccccggggaaccggtgacagctggggccggtgagcccgtcggggag
actcacccgcaaccgaccgccgcacgcgcaaaagccgaccgggaaccggccgcacggcag
aaaagcccgcaacctcgacggaaggcggcccgtgagcccgagcacgcccccgagccggca
caggccgagccccggaagcagccggccgggcagcacctgcaagcgctgccggagccgtcc
gccgggaccacctcggtgatcggcaccgggcccctcgtacggcacctggcgcagcaccgg
ggcgtagacctgacgactctgcacggcaccggaccgggcggacggatcacccgtgccgac
gtggaccgcgccgcgccgcttctcacgcccggagtccgggccactccgtacgcacggcgc
ctcgcccgcgacctcggcatcgacctggcggcggtgcggggcaccggggacggcggagcc
gtgcgggcggcggacgtgcacacggccgtgcgcgcaggcgccggggccgagcgaccgggt
cggggcccgcgtggcggcgagcagcgtccgcacgcggccgtcgcggccgacagccgcccg
gaggaccgtacggacgccatgcgccgtgccatcgccgacctcatgagccgctccaaacgg
gagatcccgcactactacctgtccaccaacgtcgacctcacggcgaccgaggactggctg
cgccggatcaaccgcggtcgtccgcccgccggccgcctcgtgcccgctgccctgctcctc
aaagccgccgccctggcagcacgcgaggtgcccactctcaacggctactggcggaacaac
ggattcgcccccgcttccgagatcaacctgggcgtcgcggtgtcgctccggcagggcggg
ctgctcgcgccggtgatccaccgcgccgacacactgccgctcgacgccctcatggcccgc
ctcaaggacctggtccaacgagcccgccgcggacggctgcgcggcagcgagacgaccgcc
gccaccctgaccgtcaccaacctgggcgaccagggcgtggacgcggtgttcggggtcgta
cacccaccccaggtggccctggtcggcttcggggcggtcgtcgagcggccctgggccgcg
aacggcatgctcggcgtgcgtccggtggtgaccgcgaccctggccgccgaccaccgggcc
acggacggagccgtgggagcgcgctacctcacggcggtcgaccgcctgctgcagcaaccc
gaggagctgtga

DBGET integrated database retrieval system