KEGG   Streptomyces hygroscopicus subsp. jinggangensis 5008: SHJG_p1071Help
Entry
SHJG_p1071        CDS       T02063                                 

Definition
guanylate kinase
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
shy  Streptomyces hygroscopicus subsp. jinggangensis 5008
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:shy00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pSHJG1:complement(64191..64760)
Genome map
AA seq 189 aa AA seqDB search
MTEKQGVILYGPPASGKDTVTTALSELDSKYAQFARLKVGTGKSAGYRMGTAEHLEELEA
AGNIVYANARYGNTYAIDRPGVEAAFAAGVPVVHLGQVDGIRALVGGYRADWSVVLLWCP
REVTEKRSAERGDSDTVARLAAWDATCEDLDAHPDMVWDLTVDTTASAPQEAARLIDQLL
AQRAGAATA
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgacggagaagcaaggcgtgatcctctacggcccgccggcctcgggcaaggacaccgtc
accaccgcgctcagcgaactcgactccaaatacgcgcagttcgcgcggctcaaggttggg
acgggcaagtccgccggctaccgaatgggcacagcagaacatctggaggaactggaagcc
gcgggcaacatcgtctacgcgaacgcccggtacggcaacacgtacgcgatcgaccggccc
ggcgtcgaggccgcgttcgcggccggggtacccgtggtgcacctcgggcaggtcgacggc
atccgagcgctggtcggcggctaccgcgctgactggtcggtggtgctgctgtggtgcccg
cgcgaggtgaccgagaagcggtctgcggagcgcggcgacagtgacaccgtggcgcgcctg
gcggcgtgggacgcgacttgcgaggacctggacgcgcacccggacatggtctgggacctg
acggtggacaccacggcgtcggcgccgcaggaggcggcacggctcatcgaccagctgctg
gcgcagcgggcgggagcggcgacggcatga

DBGET integrated database retrieval system