KEGG   Sulfolobus islandicus M.14.25: M1425_0275Help
Entry
M1425_0275        CDS       T00890                                 

Definition
succinate--CoA ligase (ADP-forming) (EC:6.2.1.5)
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
sia  Sulfolobus islandicus M.14.25
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Dicarboxylate-hydroxybutyrate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:sia01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:sia00020]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:sia00640]
Metabolism; Carbohydrate metabolism; C5-Branched dibasic acid metabolism [PATH:sia00660]
Metabolism; Energy metabolism; Carbon fixation pathways in prokaryotes [PATH:sia00720]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
239399..240412
Genome map
AA seq 337 aa AA seqDB search
MKLYEYEGKSLFKRVGIPVPNGVVTSEPIRWQGKAVVKSQLLEGARGKRGLVRVTEDVYN
TILELKKLGVEKFLVEEFVPHEKEFYASVLLDRETAEPMLVLSREGGIDVEQAKDVKKMI
IPLERGVRSYDIVEAEKYLGVKGLGQIIQGLYKLFVDYDAELVEINPLALTNDGRILALD
SKVILEDNALYRHEDLLKELGRQEVRDSYVELEGDIGIIGNGAGLTMASMDLVKLNGGNP
ANFLDVGGGANREHVKESVLKVGSNPRVKKIVINIYGGITRCDEVALGIIDALKEVKKPI
FVRLLGTNEELGKKILRENGVNVYDDVLKMIGDAVRS
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgaaattatacgaatatgagggaaagagtctttttaagcgtgtagggataccagtgcct
aatggtgttgtaacttctgaaccaataagatggcaaggaaaagctgtagtgaaatctcaa
ctattggaaggcgctagaggtaaaagaggattagtaagagtaactgaagacgtttataat
actattttagagctgaaaaaactaggagtcgagaaattcttagtagaggagtttgttcct
cacgagaaggagttttacgcttcagtattgttagatagggaaactgcggaaccaatgtta
gttttatcaagagaaggaggcattgatgttgaacaagctaaggacgttaagaagatgata
ataccactagagaggggagttaggagttatgatattgttgaggctgagaagtatctagga
gttaagggattaggacaaataatacaaggtttatataaattatttgtagattacgacgct
gaactagttgagataaacccattagcattgactaatgatggtagaatattagctttagac
tctaaagtgattttagaggataacgcgttatatagacatgaggatttgttaaaggagtta
gggaggcaagaagttcgtgatagttatgtggaactagagggagatataggaataataggc
aatggtgcaggattaaccatggcttcaatggatctagttaaattaaatggcggaaatcca
gcaaatttcttggatgttggtggaggagctaatagggaacatgttaaagaaagtgttctc
aaagtgggtagtaatcctagagtcaaaaagattgttataaatatttacggtggaattact
agatgtgatgaggtagcgttaggtataattgatgcgctaaaggaggtaaagaagccaata
tttgttagattattaggaactaacgaggaattagggaagaaaatattaagagagaacggt
gtaaacgtatatgatgatgtattaaaaatgataggtgatgcagtacgctcataa

DBGET integrated database retrieval system