KEGG   Sulfolobus islandicus M.14.25: M1425_0372Help
Entry
M1425_0372        CDS       T00890                                 

Definition
pyruvate flavodoxin/ferredoxin oxidoreductase domain-containing protein
Orthology
K00169  
pyruvate ferredoxin oxidoreductase, alpha subunit [EC:1.2.7.1]
Organism
sia  Sulfolobus islandicus M.14.25
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Pyruvate:ferredoxin oxidoreductase
Dicarboxylate-hydroxybutyrate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:sia01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:sia00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:sia00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:sia00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:sia00640]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:sia00650]
Metabolism; Energy metabolism; Carbon fixation pathways in prokaryotes [PATH:sia00720]
Metabolism; Energy metabolism; Methane metabolism [PATH:sia00680]
Metabolism; Xenobiotics biodegradation and metabolism; Nitrotoluene degradation [PATH:sia00633]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(325158..326315)
Genome map
AA seq 385 aa AA seqDB search
MQVLKRKTLALVGNHAVAYAVKQSKPQVLAVFPITPQTTMLEKISEYIASEELNAELIKV
ESEHSALASIYGAALAGARVFTATSSQGLLYMTEMIYWAGGQRVPMVAAVATRAIAEPWS
IWDDHQDFLSKRDAIWIQMMAENVQEAYDMTIQAFRISEDERVILPVMMGFDGFILTHTM
ERIEVLEDGEVDNFLPPRQFNLIDFSDPIGVGPIATPEDYIKYRYEAMKAMERAKGVIEE
VMNEYGRISGRKQNGLVECYKCEDAKYVFVTMGAWSGDGKVAVDRLRDAGVEAGLLKIRV
FRPFPKEKIEEYLRSMKGVIVLDRAYSYGSGGILANEIKATLYGYRVPVYSVIAGIGGKD
VRPRHFQKVIEDLINDNLEEERWLL
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgcaagttttaaagaggaaaaccttagctttagttggtaatcacgcagttgcttatgct
gttaagcaatctaaacctcaagttttagcggtgttcccaataactcctcaaactacaatg
ctagagaaaatttccgaatacatagcttctgaggaattaaatgctgagttaataaaggtg
gaaagtgagcattctgcgttggcttcaatttatggtgctgcattggctggtgctagagtt
ttcactgcaacgtcttctcaaggactactatacatgactgagatgatatattgggctgga
ggtcaaagagtccctatggttgctgcagttgcaactagggcaattgcagagccttggagt
atttgggatgatcatcaagatttcctaagtaagagagatgcaatttggattcaaatgatg
gcagaaaacgttcaagaggcttacgatatgacaatacaagcgtttagaatttcagaagat
gagagagtaatcttaccagtcatgatgggatttgatggcttcatattaactcacacaatg
gaaaggattgaggtattagaggatggtgaggttgacaactttttaccgcctagacaattt
aacctaattgacttctctgatcctattggtgttggaccaatcgcaactccagaggattac
atcaagtataggtatgaggctatgaaggccatggaaagagctaaaggggttattgaggaa
gtaatgaatgaatacgggaggataagtggaaggaaacaaaacggtttagtcgagtgttat
aaatgtgaagatgccaaatacgttttcgttaccatgggagcgtggagtggtgacggtaag
gttgctgtggatagactaagggatgctggggttgaggctggattgctcaaaatcagggta
tttagaccattcccaaaggagaaaatagaggaatacttaaggtcaatgaaaggtgtaata
gttctcgatagagcttattcatatggttctggggggattttagcaaatgagataaaagct
acactttatggctatagagtaccagtttacagcgtaatagcaggtattggtggaaaggac
gttagaccacgtcactttcaaaaggtgattgaagacctaatcaacgataatttggaagag
gagaggtggttgttgtga

DBGET integrated database retrieval system