KEGG   Sulfolobus islandicus M.14.25: M1425_0373Help
Entry
M1425_0373        CDS       T00890                                 

Definition
(GenBank) pyruvate ferredoxin/flavodoxin oxidoreductase, delta subunit
  KO
K00171  pyruvate ferredoxin oxidoreductase delta subunit [EC:1.2.7.1]
Organism
sia  Sulfolobus islandicus M.14.25
Pathway
sia00010  Glycolysis / Gluconeogenesis
sia00020  Citrate cycle (TCA cycle)
sia00620  Pyruvate metabolism
sia00640  Propanoate metabolism
sia00650  Butanoate metabolism
sia00680  Methane metabolism
sia00720  Carbon fixation pathways in prokaryotes
sia01100  Metabolic pathways
sia01120  Microbial metabolism in diverse environments
sia01130  Biosynthesis of antibiotics
sia01200  Carbon metabolism
Module
sia_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sia00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    M1425_0373
   00020 Citrate cycle (TCA cycle)
    M1425_0373
   00620 Pyruvate metabolism
    M1425_0373
   00640 Propanoate metabolism
    M1425_0373
   00650 Butanoate metabolism
    M1425_0373
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    M1425_0373
   00680 Methane metabolism
    M1425_0373
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    M1425_0373
Enzymes [BR:sia01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     M1425_0373
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4 Fer4_6 Fer4_7 Fer4_21 Fer4_2 Fer4_10 Fer4_16 Fer4_9 Fer4_4 Fer4_8 Fer4_17 Fer4_15 Fer4_3 Fer4_13 Fer4_22
Motif
Other DBs
NCBI-ProteinID: ACP37253
JGI: KislK10373
UniProt: C3MUL9
Position
complement(326319..326585)
Genome map
AA seq 88 aa AA seqDB search
MIKIPMGVPVARPRIGSAGKTGLWRVEKPVIDYNKCTKCRLCVIYCPENTIDLLENLYPQ
IDYDYCKGCGVCAQVCPPKAIDMVREVK
NT seq 267 nt NT seq  +upstreamnt  +downstreamnt
ttgattaaaatccccatgggagtgccagtagctaggccaaggataggatctgcgggaaaa
actggattatggagagttgagaaaccagtaattgattacaataagtgtactaagtgtaga
ctttgcgtaatttattgcccagaaaatactattgatctcctagagaacctctatcctcaa
attgattacgattattgtaaaggttgtggtgtttgcgcacaagtttgcccacctaaggca
atagatatggttagggaggtgaagtga

DBGET integrated database retrieval system