KEGG   Sulfolobus islandicus M.14.25: M1425_0503Help
Entry
M1425_0503        CDS       T00890                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
sia  Sulfolobus islandicus M.14.25
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:sia00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(439853..441358)
Genome map
AA seq 501 aa AA seqDB search
MNTMSHKFVLALDEGTTSARAILFDSDLNIVNIGQYEFPQHYPQPGYVEHDPEEIWEAQM
LAVKKAISKIDAKQIVAIGITNQRETTVLWDAKSGKPVYNAIVWQDRRTSPITDWLKANY
FKMIKDKTGLVPDPYFSASKIKWILDNVSNVREKAERGEIKFGTIDTYLIWRLTNGKAHV
TDYSNASRTMLFNINKLEWDREILELLKIPESILPEVKPSSEIYGYSEALGNLIPISGDA
GDQQAALFGQVAFNVGEIKATYGTGSFILMNIGNNPIRSENLLTTIAWGLEKNKAKYALE
GSIFITGAAVQWFRDGLRAIDVSDEIEPLASSVEDNGGVYFVPAFVGLGAPYWDPYARGL
IIGITRGTTKAHIARAILESMAYQTRDVIEVMQKEAGISINSLKVDGGAAKDNLLMQFQA
DILGIKVIRPKVMETTSMGVAMLAGLGVGLWNSLEELRNIWKVDKEFIPSMSEEKRRALY
SGWKEAVKRAMGWAKVVGGQV
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgaatactatgtcacataagtttgttctagccctagatgagggtactacaagtgctagg
gctatactcttcgatagtgacttaaacatagtaaacatagggcaatatgaattcccgcag
cactatcctcaacctggctatgtggaacatgaccctgaggaaatatgggaagctcaaatg
ttagccgtaaaaaaggctataagtaaaatagatgctaaacaaatagtagcaatagggata
acaaaccaaagggagacaacggtattatgggatgctaaaagcggtaaaccggtttacaat
gcaattgtatggcaggatagaagaacttctccaataacggactggctaaaagcaaattac
tttaaaatgataaaggacaaaactgggttagttccagacccttactttagtgcatctaag
ataaagtggatacttgataatgtgtccaatgttagggagaaagcagaaagaggagaaatt
aagttcgggaccatagatacttatttaatctggaggcttactaatggaaaagctcatgta
actgattactctaacgcttctagaacaatgctttttaatataaataaattagaatgggat
agagaaatcttagaacttctaaaaatacccgaatctatattgccagaggttaaaccatca
agtgaaatttacggttacagtgaggcgttaggaaacttaatacctatatctggggacgca
ggagaccaacaagcagctttattcggtcaggtagcgtttaacgtaggtgagataaaagct
acttatggtaccggtagtttcattttaatgaatataggcaataacccaatacgatcagaa
aacctcttaactacaatagcttggggtcttgagaagaataaggcaaagtatgcattagag
gggagtatattcataactggtgcagctgtacaatggtttagggacggcttacgggcaata
gacgtttcagatgagattgaacctttagcctcaagtgtggaagataatggcggtgtctat
ttcgttccagcttttgttggattgggagctccttactgggatccatatgctagaggtctc
ataataggcataactagaggaactactaaagctcatatagctagggctattttagaatca
atggcctatcaaactagagatgtaattgaggtaatgcaaaaggaagccggcatcagtata
aattcgcttaaggttgacggaggtgcagctaaggataaccttttaatgcaattccaagct
gatatattaggtattaaggtaatcagacctaaagttatggaaactacttctatgggagtt
gcaatgttagcaggtttaggtgtaggcttatggaactctttagaggaattaaggaacata
tggaaggttgataaggaattcattccaagtatgagtgaggagaaaaggagggcattgtac
tctgggtggaaggaggctgtaaagagagctatgggatgggctaaagttgtaggaggtcaa
gtttaa

DBGET integrated database retrieval system