KEGG   Sulfolobus islandicus M.14.25: M1425_0518Help
Entry
M1425_0518        CDS       T00890                                 

Definition
medium-chain-fatty-acid--CoA ligase AlkK
Orthology
K14466  
4-hydroxybutyryl-CoA synthetase (4-hydroxybutyrate-CoA ligase, AMP-forming) [EC:6.2.1.-]
Organism
sia  Sulfolobus islandicus M.14.25
Pathway
Carbon fixation pathways in prokaryotes
Microbial metabolism in diverse environments
Carbon metabolism
Module
Dicarboxylate-hydroxybutyrate cycle
Hydroxypropionate-hydroxybutylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:sia01200]
Metabolism; Energy metabolism; Carbon fixation pathways in prokaryotes [PATH:sia00720]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(460174..461598)
Genome map
AA seq 474 aa AA seqDB search
MSAVKNEYDAIHRELREQGFIRTDYPPNPSEVLWNKKIMTMKREEIDKLKTFRLRRIIKW
AWENIEFYRRFWKSKNFEPDMIKDWRDIAKIPILRKDEIRKDLQQNPPFGTIFHPELANH
IRFVGATSGSTGLPTFQGWGALEMDYFQEAQARYLWTFAEVKPTKVYANYLNMSGFYSWG
PPVVETAMWRCGATVIAGGGETYFSWKNRHNLIFKLWKVDVFATTPWLHRLVGEEAKIEG
WETPFKVLLLHGGAAAENTKKKLFKVHPNAELAISVWGTTDGHMAIEVPSLEGQLVVWED
MEIFDIVDPKTDEPVSGGERGELIATLLNHFTMPLIRYSLGDYVKNDFLTDPDPKYSITH
MRFAEPIPGRVEWMFFVKGKLLLPIYVEDAVNEIPDTTGMFNIFIYDNSMDKLKIRIETR
REQVNSTYDKQAREILASRIGINPDDVEIEWVKPGNTIWTGYKLQVFVDQRKKK
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcagttaaaaacgaatacgatgcaattcatagggaattgcgagaacaaggtttt
attagaactgattatcccccaaatccatctgaagtgttatggaataagaagataatgaca
atgaaaagagaggaaatcgataagttaaagacgtttagactaaggaggattataaagtgg
gcatgggaaaacattgagttctatagaaggttttggaagtctaaaaacttcgaaccagac
atgataaaggactggagggatatcgctaaaataccgatattgagaaaagatgaaattagg
aaagacctacagcaaaatcctccatttggtacaattttccatccagaattggctaatcac
ataagatttgttggagcaacttctggctcaactggattacctactttccaaggatggggg
gctttggaaatggactacttccaagaagcccaggcaaggtacttgtggacttttgccgaa
gttaagccaactaaggtttacgcgaactacctaaacatgagtggcttttatagttggggg
cctccggttgttgagaccgcaatgtggagatgtggggcaactgtcatagctggaggtggt
gagacttacttctcatggaagaatagacacaacttgatcttcaaactatggaaagttgac
gtattcgccacaactccttggctacatagattagtaggagaggaggctaaaattgagggt
tgggaaactcctttcaaggttttgctacttcacggcggtgcagctgctgaaaacactaaa
aagaaattattcaaggttcatccaaatgctgaattggctataagtgtttggggaaccact
gatggacatatggctattgaagttccaagcttagaaggacaattagtagtttgggaggac
atggagatatttgatattgtagaccctaagactgatgaaccagtatctgggggagaaaga
ggtgaactgatagcgaccttgttaaatcactttaccatgcctttaatacgctatagttta
ggagattacgttaagaatgacttcctgaccgatccggatcctaagtatagtataactcac
atgagatttgctgagccaataccaggtagggttgagtggatgttcttcgttaaagggaaa
ctattattgccaatttacgttgaggacgctgtgaatgaaattccagacactactggaatg
tttaacatttttatttacgataatagtatggataaattgaagattagaatagagacaagg
agggaacaggttaattctacttacgataagcaagccagagagatattagcgagcaggatt
gggattaacccagatgacgttgagatagagtgggtaaagcctggaaacacaatatggaca
ggctacaagttgcaagtgtttgtcgaccagaggaagaagaaataa

DBGET integrated database retrieval system