KEGG   Sulfolobus islandicus M.14.25: M1425_0573Help
Entry
M1425_0573        CDS       T00890                                 

Definition
(GenBank) acetylornithine deacetylase or succinyl-diaminopimelate desuccinylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
sia  Sulfolobus islandicus M.14.25
Pathway
sia00300  Lysine biosynthesis
sia01100  Metabolic pathways
sia01120  Microbial metabolism in diverse environments
sia01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sia00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    M1425_0573
Enzymes [BR:sia01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     M1425_0573
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28
Motif
Other DBs
NCBI-ProteinID: ACP37411
JGI: KislK10573
UniProt: C3MV48
Position
complement(521025..522236)
Genome map
AA seq 403 aa AA seqDB search
MILDEIVEASKDEIVEFLKQLIRIPTENPPGLNYDKIISVLRDKLEEFGYKTEIIEGNKE
FVKFGNGNRPNLVGYLGNGNVRIAFNGHYDVVPAGEGWSINPYEGIEKDGKVYGRGASDM
KSGIVAQIYAVEMLKRAKLLPSNVKIIQTIVPDEETVGNKNAGTYCLREIYKKNADYVIF
TEPTGPDNICNGHRGAIWAVVKIYGKKSHGGFPQLGIDAAKAVAIMIERLYSSLSNITSK
YNIVPEAGKKPSILVGTVKCGTWVNTVADYCEFSIVRRLIPEERIDEVRESILRLLRDVS
SETGVKFDYDEFYAVDTVVSEDGRLIDALRKAIREVRGVDPNVVLSAGTFDIRFTVSEGI
KSINYGPGRIELAHSTDEFVYVKDLLDSIKALGRVLLEVAKGS
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgatattggatgagatcgttgaagcctctaaggatgaaattgtggagttcttaaagcag
ttaataaggatcccaactgagaatcctcccggcttaaattacgataagataattagcgtg
ttgagggataaattagaagagtttgggtataaaacggaaattattgagggtaataaagag
tttgtcaagttcggaaatggcaatagaccaaatctagtaggttatttgggtaatggcaac
gtaaggattgcgtttaatggacattacgatgttgttcccgccggtgagggatggagtatt
aacccttatgaggggattgaaaaagatggcaaggtttacggaagaggagcttctgacatg
aagtctggaatagttgcacaaatttacgctgttgaaatgttaaagagagctaaactactc
ccctctaacgtgaaaatcatccagaccattgtcccagatgaggagactgtaggcaataaa
aatgctggtacttattgtttaagggaaatctacaagaaaaacgcagattacgtaatattc
acagaacctactggaccagataacatttgcaatggtcataggggtgcaatctgggctgtg
gttaaaatatatgggaagaaaagtcatggaggttttcctcaattaggaattgacgcagcc
aaggctgtagcgattatgattgaaagactttactcgtctttatccaacattacctcaaag
tacaacattgtaccagaggctggtaagaaaccgtcaatattagttggtactgttaagtgt
ggtacgtgggttaacactgtagcagactactgtgagttcagtatagttaggagattaatc
ccagaggagaggattgatgaggttagggagagcattttacggttgttaagggatgtgagt
agtgagactggcgttaagtttgattacgatgagttttacgctgtcgatactgtagtaagt
gaggatgggagactaatagatgctctgagaaaggctataagggaggttaggggagttgat
cccaatgttgttttatctgcagggactttcgatattaggtttaccgtaagtgaggggata
aagagtattaattacggtccgggtaggattgagttagcacattctacagatgagttcgtt
tacgttaaagatttattggattcaataaaagcgttaggaagagtactattggaggtggct
aaaggaagttag

DBGET integrated database retrieval system