KEGG   Sulfolobus islandicus M.14.25: M1425_0645Help
Entry
M1425_0645        CDS       T00890                                 

Definition
nucleotidyl transferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
sia  Sulfolobus islandicus M.14.25
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sia00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    M1425_0645
   00052 Galactose metabolism
    M1425_0645
   00500 Starch and sucrose metabolism
    M1425_0645
   00520 Amino sugar and nucleotide sugar metabolism
    M1425_0645
Enzymes [BR:sia01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     M1425_0645
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
591035..591787
Genome map
AA seq 250 aa AA seqDB search
MHAVITAAGLGTRMLPASKEIPKEMFPIPFNNGFKPIIQIIFEQLYNKGIRDFVIVVGRG
KRVIEDHFTPDYDFVSYLEKVGKEKQARELLTFYSKIEKSNIAFVNQPEPKGFGDAVLRV
EPFINDKFIVVAADTLLREIPDLIPNSFLVTEVEDPRPYGVVILEGDRVIDVEEKPKNPK
SRFIIVPYYMFTYDIFHALREVKCNGELQLTEGIKILLKKGVEFIAKRVNDVYDLGSIEN
YIASIKKIIG
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgcatgcagtaataactgcagctggattaggcactcgaatgttacccgcttctaaagaa
attcctaaggagatgtttccaattccctttaacaatggatttaagccaattatacaaata
atctttgagcaactttataacaagggtataagggatttcgttatagttgttggtaggggt
aagagggtaattgaagatcattttacaccagattacgattttgtctcttaccttgaaaaa
gtaggtaaagaaaagcaggcaagggagttattaacattttactctaaaatagagaaaagc
aatatagcatttgtaaatcagcctgaaccaaaaggatttggagatgcggtactgagagta
gaaccttttattaatgataaattcattgtagtagcagcagacactctattaagagagatt
ccagatttaatacctaactcttttctagttactgaagtagaagatcctagaccatatggt
gtagtaatattagagggagatagagttatagatgtcgaggaaaaacctaagaatcctaaa
tcccgttttataatagttccttactatatgtttacatatgatatatttcacgccttaaga
gaagttaagtgtaacggagaattacaacttactgaagggataaaaatattgctgaaaaaa
ggtgtggaatttattgcaaaaagagtaaatgatgtttatgatctgggtagtatagagaat
tatattgcatccataaagaaaattattggataa

DBGET integrated database retrieval system