KEGG   Sulfolobus islandicus M.14.25: M1425_0704Help
Entry
M1425_0704        CDS       T00890                                 

Definition
AMP-dependent synthetase and ligase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
sia  Sulfolobus islandicus M.14.25
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sia00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    M1425_0704
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    M1425_0704
   00620 Pyruvate metabolism
    M1425_0704
   00640 Propanoate metabolism
    M1425_0704
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    M1425_0704
   00680 Methane metabolism
    M1425_0704
Enzymes [BR:sia01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     M1425_0704
Lipid biosynthesis proteins [BR:sia01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   M1425_0704
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(657317..658813)
Genome map
AA seq 498 aa AA seqDB search
MASYEEVRRSFSWSEVIRYLDKNPLDVLTSNDGIAVRRFTKNAMEEISFSDLKRKALRLA
LYLKEFHNVKKGDVIAVLASKKIQQVIILLATLSLGAIYQPLFTAFGPEAIKMRTRDVKP
KVIFCQDDQKDKVNNAISFSKFDELLSYGELKEIEKINWDDAIILLYTSGTTGTPKGALI
AKRLLLNTYVYMKYGIGVRENDVFWNPADPGWAYGLYYGIIGPLMFGKTIIFLDEPFNPE
RTMEFMEENKVTNFAFAPTAYRMIAGMVKKKYDLVLERASSAGEPLNPEVIRWFMDKYNV
TIKDHYGQTEVGMVVYNGWGYDAKVKIGSMGLPAPGYEVDIIEDIIAVKRDSPGFHFLGY
LNNPEKTKESFRGDWYLTGDNAYKDEEGYLWFVGRKDDVVKVSGYRIGPFEVESVLLEFP
AVLESAVVADEDPIRGHVLHAYIVLKSGYTPSEELKKEIIDFVNTKYSRHVHLERVDFVD
KLPKTESGKIQRYLLRKK
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atggctagttatgaagaagttaggagaagtttttcgtggagtgaggtaattagatattta
gacaagaacccattagacgttttgacttctaatgacggtatagcagttaggagattcact
aagaacgctatggaggagataagcttctcagatcttaaaagaaaggcattaagacttgcc
ttatatctcaaggaatttcataatgttaaaaagggtgatgtaatagcagtattagcttca
aagaagattcaacaagtcataatacttttagcaactctctccctaggagcaatttatcaa
ccattatttactgcatttgggccagaggcaattaagatgaggactagagatgtaaaacca
aaagttatcttttgtcaagacgatcaaaaggataaggtaaataatgcaatatccttctcc
aagttcgatgaattattaagttacggtgaattgaaagagattgaaaagataaattgggat
gatgcgataattttactttacacttctggtactacgggaacacctaaaggggccctaatc
gctaagaggctacttcttaacacttatgtctacatgaaatatggtataggtgttagggaa
aatgacgtgttttggaaccccgcagatcctggatgggcttatgggctatattatggtata
ataggaccactaatgtttgggaaaactataatcttccttgacgaaccatttaacccagaa
aggacaatggagttcatggaggaaaataaggttactaattttgctttcgcacctacggca
tatagaatgatagctggaatggttaagaagaagtatgatttagtattggaaagagcgagt
tctgcaggtgaaccacttaacccagaagttataagatggtttatggataagtacaatgtt
actatcaaagatcattatggacaaactgaagttggaatggtagtttataacggctgggga
tatgacgcaaaagtaaaaatagggagtatgggattacctgcacctggttatgaagtcgat
ataatagaggatattatagctgtcaagagagattctccaggtttccacttcttgggatat
ctaaacaatccagagaagaccaaggaatcatttcgaggcgattggtacttgactggtgat
aatgcgtataaagatgaggaaggatatttatggtttgttggaaggaaggacgatgtggtt
aaggtatctggttacaggataggtccatttgaagttgagagcgtacttctagaatttccc
gcagtactagaatctgctgttgttgccgatgaagatccaatacgaggacatgtattgcat
gcttatattgtactcaaaagtggatacactccaagtgaggaactaaagaaggagattatt
gattttgtaaatactaaatattctaggcatgtacatctagaaagggttgactttgttgat
aaattgccaaagactgagagtggtaaaatacaaagatatctacttagaaagaaataa

DBGET integrated database retrieval system