KEGG   Sulfolobus islandicus M.14.25: M1425_0945Help
Entry
M1425_0945        CDS       T00890                                 

Definition
(GenBank) dTDP-4-dehydrorhamnose 3,5-epimerase
  KO
K01790  dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
sia  Sulfolobus islandicus M.14.25
Pathway
sia00521  Streptomycin biosynthesis
sia00523  Polyketide sugar unit biosynthesis
sia01130  Biosynthesis of antibiotics
Module
sia_M00793  dTDP-L-rhamnose biosynthesis
Brite
KEGG Orthology (KO) [BR:sia00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    M1425_0945
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    M1425_0945
Enzymes [BR:sia01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     M1425_0945
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: dTDP_sugar_isom Peptidase_M17
Motif
Other DBs
NCBI-ProteinID: ACP37733
JGI: KislK10945
UniProt: C3MX53
Position
complement(899273..899803)
Genome map
AA seq 176 aa AA seqDB search
MPFEFENLGMGIVLIKPKVFPDKRGFFLEVFKSEDFTKAEIPNIVQVNMSSSLKGVVRGL
HYQITPKEQGKLVFVPKGKILDVAVDLRKSSPTFGKYVKVELNDENHYILWIPPGFAHGF
QALEDSIVVYFLTHNEYSKSHERCVNYSYVDWPIKEFIISDKDLQCPPLEKAEVFK
NT seq 531 nt NT seq  +upstreamnt  +downstreamnt
atgccgtttgaattcgaaaacttaggaatgggtattgtcctcataaagccgaaagtcttc
ccagataaaagaggcttctttctagaggtatttaaatctgaagacttcactaaagcagaa
attcctaatatcgtacaagttaatatgtcgtcctctcttaaaggagtagttagaggattg
cactatcagataactcccaaggaacaaggcaagttagtatttgttcctaaaggtaaaata
ttggacgttgctgtagacctaagaaaatcctcacctactttcgggaaatacgttaaagtt
gagcttaacgatgagaaccactacatactatggatacctccgggttttgcccatggattt
caagcattagaagattcaatagtagtctacttcctaactcacaacgaatactctaaatct
cacgagagatgcgtaaactactcttatgtagactggccaataaaggaatttattataagc
gataaggatttacaatgcccgcccttagaaaaggcagaagtctttaagtga

DBGET integrated database retrieval system