KEGG   Sulfolobus islandicus M.14.25: M1425_1439Help
Entry
M1425_1439        CDS       T00890                                 

Definition
(GenBank) ribosomal protein L18P/L5E
  KO
K02881  
large subunit ribosomal protein L18
Organism
sia  Sulfolobus islandicus M.14.25
Pathway
Ribosome
Module
Ribosome, archaea
Brite
KEGG Orthology (KO) [BR:sia00001]
 Genetic Information Processing
  Translation
   03010 Ribosome
    M1425_1439
Ribosome [BR:sia03011]
 Ribosomal Proteins
  Mitochondria/ Chloroplast
   Large subunit
    M1425_1439
  Bacteria
    M1425_1439
  Archaea
    M1425_1439
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
1349344..1349934
Genome map
AA seq 196 aa AA seqDB search
MANGPNYKIKPRRRREGKTNYYKRYVYVISKQIRFIVRITNKYVIVQIAKIDPKGDIMVA
SAHSSELTKKFEWKGDENNTPSAYLTGYLAALRAVKKGVTECVADIGLHVPSKGNKVFYA
IKGAIDAGLKIPIGDISIENDRIKGEHIAKYAEKLKSENLDLYNKLFSRYLGRGLNPENL
PSHFEEILNKIKSSGG
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
ttggccaatggtcctaattataagataaaacctaggagaagaagagaaggaaaaactaac
tactataagagatatgtttatgtcataagtaaacaaataaggtttattgtaagaataacg
aacaaatacgttatagttcaaattgcaaaaatcgatcctaagggcgatatcatggttgct
agtgctcattcttcagaacttactaaaaagtttgaatggaagggagatgaaaataatact
ccctccgcataccttactggatatttagcagctttaagagctgtgaagaaaggcgtaaca
gagtgtgttgcagatataggacttcatgtaccgtccaagggtaataaggtgttctatgca
ataaaaggtgcaatagatgctgggttgaaaattccgataggtgatataagtatagaaaac
gatagaataaagggagagcatatagccaagtatgctgaaaagttgaaatctgagaattta
gatttatataataaactattttcaaggtatttgggaaggggactaaatcctgagaactta
ccctctcattttgaggagatattaaacaagattaaatcttctggtggttga

DBGET integrated database retrieval system