KEGG   Sulfolobus islandicus M.14.25: M1425_1439Help
Entry
M1425_1439        CDS       T00890                                 

Gene name
rpl18p
Definition
50S ribosomal protein L18
Orthology
K02881  
large subunit ribosomal protein L18
Organism
sia  Sulfolobus islandicus M.14.25
Pathway
Ribosome
Module
Ribosome, archaea
Class
Genetic Information Processing; Translation; Ribosome [PATH:sia03010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1349344..1349934
Genome map
AA seq 196 aa AA seqDB search
MANGPNYKIKPRRRREGKTNYYKRYVYVISKQIRFIVRITNKYVIVQIAKIDPKGDIMVA
SAHSSELTKKFEWKGDENNTPSAYLTGYLAALRAVKKGVTECVADIGLHVPSKGNKVFYA
IKGAIDAGLKIPIGDISIENDRIKGEHIAKYAEKLKSENLDLYNKLFSRYLGRGLNPENL
PSHFEEILNKIKSSGG
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
ttggccaatggtcctaattataagataaaacctaggagaagaagagaaggaaaaactaac
tactataagagatatgtttatgtcataagtaaacaaataaggtttattgtaagaataacg
aacaaatacgttatagttcaaattgcaaaaatcgatcctaagggcgatatcatggttgct
agtgctcattcttcagaacttactaaaaagtttgaatggaagggagatgaaaataatact
ccctccgcataccttactggatatttagcagctttaagagctgtgaagaaaggcgtaaca
gagtgtgttgcagatataggacttcatgtaccgtccaagggtaataaggtgttctatgca
ataaaaggtgcaatagatgctgggttgaaaattccgataggtgatataagtatagaaaac
gatagaataaagggagagcatatagccaagtatgctgaaaagttgaaatctgagaattta
gatttatataataaactattttcaaggtatttgggaaggggactaaatcctgagaactta
ccctctcattttgaggagatattaaacaagattaaatcttctggtggttga

DBGET integrated database retrieval system