KEGG   Sulfolobus islandicus M.14.25: M1425_1581Help
Entry
M1425_1581        CDS       T00890                                 

Definition
(GenBank) glyceraldehyde-3-phosphate dehydrogenase, type II
  KO
K00150  glyceraldehyde-3-phosphate dehydrogenase (NAD(P)) [EC:1.2.1.59]
Organism
sia  Sulfolobus islandicus M.14.25
Pathway
sia00010  Glycolysis / Gluconeogenesis
sia01100  Metabolic pathways
sia01110  Biosynthesis of secondary metabolites
sia01120  Microbial metabolism in diverse environments
sia01130  Biosynthesis of antibiotics
sia01200  Carbon metabolism
sia01230  Biosynthesis of amino acids
Module
sia_M00002  Glycolysis, core module involving three-carbon compounds
sia_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sia00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    M1425_1581
Enzymes [BR:sia01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.59  glyceraldehyde-3-phosphate dehydrogenase (NAD(P)+) (phosphorylating)
     M1425_1581
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Gp_dh_C DapB_N Gp_dh_N NAD_binding_3 2-Hacid_dh_C Sacchrp_dh_NADP
Motif
Other DBs
NCBI-ProteinID: ACP38330
JGI: KislK11581
UniProt: C3MWN0
Position
1471268..1472290
Genome map
AA seq 340 aa AA seqDB search
MISVAVNGYGTIGKRVADAILKQPDMRLIGVAKTSPNYEAFIAHRKGIKIYVPQQSIKKF
EESGIPVAGTIEDLVKASDIVVDTTPNGVGAQYKPIYQQFQRNAIFQGGEKAEVADISFS
ALCNYDEALGKKYIRVVSCNTTALLRTICTINKVTKVEKVRATIVRRAADQKEVKKGPIN
SLVPDPATVPSHHAKDVNSVIKNLDIVTMAVIAPTTLMHMHFINITLKDKVEKKDVLSVL
ENTPRIVLISSKYDAEATAELVEVARDLKRERNDIPEVMVFDDSVYVKDNEVMLMYAVHQ
ESIVVPENVDAIRASTRLMSAEDSIRITNESLGILKGYLI
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
gtgattagtgtagctgttaatggatatggtactataggtaagagagtcgctgatgctatc
cttaaacaaccagatatgagactaataggggttgcaaagacatctccaaattacgaagcg
tttatagcacatcgtaaggggataaagatttacgtcccacaacaatctattaagaaattc
gaagaatctggaataccagttgctggcacaatagaggacctagtaaaagcctctgatatt
gtagtagatactacgcccaatggtgttggtgcacaatataagccaatttaccaacaattc
caaaggaacgctatattccaaggtggagaaaaagcggaagttgctgatatttcgttctca
gccttatgcaattacgatgaggcccttggcaaaaagtacattagagtcgtgtcatgtaat
actacagcactactaagaacaatatgcacaataaataaggtcactaaagttgaaaaagtt
agggcaacaatagttagaagagctgcagatcaaaaggaagttaagaaaggtcctataaat
tcattagtaccagaccctgcaactgtaccaagtcatcatgcaaaagacgttaacagtgtc
attaaaaatttagatatagttacaatggcagtaatagctccaacaacgttaatgcatatg
cactttattaacataaccttaaaggataaggtagagaaaaaagatgtacttagcgttctg
gagaacactcctaggatagtcctaatctcctcaaagtatgatgcagaagctacagcagaa
ttagtagaagtagcaagagatctgaaaagggaaagaaatgatattccagaggtgatggtg
ttcgatgactctgtttatgttaaggataacgaggttatgttaatgtatgcagtgcatcaa
gaatcaatagtggtaccagaaaatgtggatgcaataagggcctccactagattaatgagt
gcagaagactcaataagaattacaaatgaaagtttaggaatattaaaggggtacctaata
tga

DBGET integrated database retrieval system