KEGG   Sulfolobus islandicus M.14.25: M1425_1581Help
Entry
M1425_1581        CDS       T00890                                 

Definition
glyceraldehyde-3-phosphate dehydrogenase (EC:1.2.1.59)
Orthology
K00150  
glyceraldehyde-3-phosphate dehydrogenase (NAD(P)) [EC:1.2.1.59]
Organism
sia  Sulfolobus islandicus M.14.25
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Class
Metabolism; Overview; Carbon metabolism [PATH:sia01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:sia01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:sia00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1471268..1472290
Genome map
AA seq 340 aa AA seqDB search
MISVAVNGYGTIGKRVADAILKQPDMRLIGVAKTSPNYEAFIAHRKGIKIYVPQQSIKKF
EESGIPVAGTIEDLVKASDIVVDTTPNGVGAQYKPIYQQFQRNAIFQGGEKAEVADISFS
ALCNYDEALGKKYIRVVSCNTTALLRTICTINKVTKVEKVRATIVRRAADQKEVKKGPIN
SLVPDPATVPSHHAKDVNSVIKNLDIVTMAVIAPTTLMHMHFINITLKDKVEKKDVLSVL
ENTPRIVLISSKYDAEATAELVEVARDLKRERNDIPEVMVFDDSVYVKDNEVMLMYAVHQ
ESIVVPENVDAIRASTRLMSAEDSIRITNESLGILKGYLI
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
gtgattagtgtagctgttaatggatatggtactataggtaagagagtcgctgatgctatc
cttaaacaaccagatatgagactaataggggttgcaaagacatctccaaattacgaagcg
tttatagcacatcgtaaggggataaagatttacgtcccacaacaatctattaagaaattc
gaagaatctggaataccagttgctggcacaatagaggacctagtaaaagcctctgatatt
gtagtagatactacgcccaatggtgttggtgcacaatataagccaatttaccaacaattc
caaaggaacgctatattccaaggtggagaaaaagcggaagttgctgatatttcgttctca
gccttatgcaattacgatgaggcccttggcaaaaagtacattagagtcgtgtcatgtaat
actacagcactactaagaacaatatgcacaataaataaggtcactaaagttgaaaaagtt
agggcaacaatagttagaagagctgcagatcaaaaggaagttaagaaaggtcctataaat
tcattagtaccagaccctgcaactgtaccaagtcatcatgcaaaagacgttaacagtgtc
attaaaaatttagatatagttacaatggcagtaatagctccaacaacgttaatgcatatg
cactttattaacataaccttaaaggataaggtagagaaaaaagatgtacttagcgttctg
gagaacactcctaggatagtcctaatctcctcaaagtatgatgcagaagctacagcagaa
ttagtagaagtagcaagagatctgaaaagggaaagaaatgatattccagaggtgatggtg
ttcgatgactctgtttatgttaaggataacgaggttatgttaatgtatgcagtgcatcaa
gaatcaatagtggtaccagaaaatgtggatgcaataagggcctccactagattaatgagt
gcagaagactcaataagaattacaaatgaaagtttaggaatattaaaggggtacctaata
tga

DBGET integrated database retrieval system