KEGG   Sulfolobus islandicus M.14.25: M1425_1614Help
Entry
M1425_1614        CDS       T00890                                 

Definition
(GenBank) Pyridoxal-5'-phosphate-dependent protein beta subunit
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
sia  Sulfolobus islandicus M.14.25
Pathway
sia00260  Glycine, serine and threonine metabolism
sia00750  Vitamin B6 metabolism
sia01100  Metabolic pathways
sia01110  Biosynthesis of secondary metabolites
sia01120  Microbial metabolism in diverse environments
sia01230  Biosynthesis of amino acids
Module
sia_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:sia00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    M1425_1614
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    M1425_1614
Enzymes [BR:sia01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     M1425_1614
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Zn-ribbon_8 DFP
Motif
Other DBs
NCBI-ProteinID: ACP38362
JGI: KislK11614
UniProt: C3MWR2
Position
complement(1502360..1503385)
Genome map
AA seq 341 aa AA seqDB search
MVKEVCMKCRKERESIYEIKCNKCGGPFEILIDFEFDKNSERGFPYSEKIFPYIKHFISL
GEGRTPLIKKGNIWFKLDFLNPSGSYKDRGAVTLVSYLAEKGVKQISEDSSGNAGSAIAA
YSAAAGIEAYIFVPETAKGGKLKQIESYGAHVVRVRGSREDVAKAAENSGYYYASHVLQP
QFRDGIRTLAYEIAKDLDWKIPNYVFIPVSAGTLLLGAYKGFKHLLDSGVISEMPKIVAV
QTEQVMPLCAKFKKNSYTPPDKVTSIADALVSTRPFLLDYMVKASSECIVVSDNEIVEAW
KELAKMGLLVEYSSATVFAAYKKYSVNDAVLVLTGSGLKVL
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaagaggtttgtatgaaatgcagaaaggaaagggaaagtatatacgagattaag
tgtaacaaatgcggaggaccattcgagatcctgatagattttgaatttgataagaattct
gagagaggttttccctatagtgaaaagattttcccttacatcaaacatttcatatcccta
ggagagggaagaactccattaattaaaaaggggaacatatggtttaaactcgacttctta
aatccatcaggatcatacaaggatagaggagcagtgactctggtctcttatcttgcggaa
aaaggtgtaaaacaaattagtgaagactcttctggaaatgcaggatcagcaatagctgcg
tattctgcagctgctggtattgaggcatacattttcgttcctgaaacggcaaaaggagga
aaacttaagcaaatagaatcctacggtgctcacgttgttagagtaagggggagtagagaa
gatgtagcaaaagctgcagagaattctggttactattacgcatcacatgttttgcaacct
caatttagagatgggattagaactctggcatatgaaattgcaaaggatttagattggaaa
attcctaattatgttttcattccagtatcagcaggaactttacttttaggtgcttataag
gggttcaagcacttgctagattctggtgtcatatcggaaatgcctaaaatcgtagcagtc
caaacagagcaagttatgccactttgtgctaaattcaaaaagaattcttacacaccacca
gacaaggttacctccattgcagacgctttagtatcaactagaccatttctattagattat
atggtaaaggcttctagtgaatgcatagttgtaagcgataatgaaatagtagaagcttgg
aaagaattggctaaaatggggctgctggtagaatatagttctgctactgtatttgctgct
tataagaaatacagtgttaacgatgcagtattagttttaaccggtagcggattaaaggta
ttatga

DBGET integrated database retrieval system