KEGG   Sulfolobus islandicus M.14.25: M1425_1951Help
Entry
M1425_1951        CDS       T00890                                 

Definition
uroporphyrinogen III synthase
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
sia  Sulfolobus islandicus M.14.25
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sia00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    M1425_1951
Enzymes [BR:sia01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     M1425_1951
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1791383..1792087)
Genome map
AA seq 234 aa AA seqDB search
MRILFLRPDNEDTELNEKLMLLQKNGIEVLNIPIFKIKCIPYSLPNYDYEALAFTSRNSV
ICFKEHFLIKNRKIYAIGEETSELLMRMYNTNPITPEKFTSVELARRILEDKVNSVLSIR
SKKASEDMKNLLNGKIKYDEIYVYDSEIIRDNINKVSKILAKCEVDAIAFTSSLMARLIG
PYISRKCKIIVYSIGPITTETLKRVNNEVKIIESKTHSIKGIIETILVEMKRNG
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atgagaatattattccttaggcccgataacgaagacacggagctcaatgaaaagcttatg
ctccttcagaaaaatggaattgaggttctaaacatacccatttttaaaataaaatgtatc
ccgtattcattaccgaactatgattatgaggcccttgcatttacaagtagaaattcagtt
atttgttttaaagaacatttcctcattaaaaatcgtaagatatacgccataggagaagaa
acttcagagttactaatgagaatgtacaatacaaatccaataactccagagaaatttaca
agcgtagaactagctagaagaatcttggaagataaggtaaatagtgtgctcagcataagg
agtaaaaaagcttctgaagatatgaaaaatcttcttaatggcaaaattaaatatgatgag
atctatgtatatgattcggaaataattagagataatataaataaagtgtcaaaaatccta
gctaaatgtgaagtcgatgccatagcatttactagctcattgatggcaaggctaattggc
ccttatattagtagaaagtgtaagattatagtatatagcataggtccgattacgacggaa
actttgaaacgggttaataatgaggtaaaaataatagaaagtaagacacattctatcaaa
ggcattatagaaactattttggtggagatgaaacgaaatggatga

DBGET integrated database retrieval system