KEGG   Sulfolobus islandicus M.14.25: M1425_2569Help
Entry
M1425_2569        CDS       T00890                                 

Definition
pyruvate ferredoxin oxidoreductase subunit beta
Orthology
K00170  
pyruvate ferredoxin oxidoreductase, beta subunit [EC:1.2.7.1]
Organism
sia  Sulfolobus islandicus M.14.25
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Pyruvate:ferredoxin oxidoreductase
Dicarboxylate-hydroxybutyrate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:sia01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:sia00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:sia00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:sia00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:sia00640]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:sia00650]
Metabolism; Energy metabolism; Carbon fixation pathways in prokaryotes [PATH:sia00720]
Metabolism; Energy metabolism; Methane metabolism [PATH:sia00680]
Metabolism; Xenobiotics biodegradation and metabolism; Nitrotoluene degradation [PATH:sia00633]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2387808..2388707
Genome map
AA seq 299 aa AA seqDB search
MSLGLREILNKHNGILSGTSACPGCPENMAMRMLGMGLGKDMVLVVVAGCSSVIQGNAPY
NAYNFPTVNVAFAAGPATAAGLARAYKQRGKNVTVVVWAGDGGSADIGFASLSGAAERND
NILYLTVDNEAYMNSGGQRSGSTPFGAITTTTPEGKKENKKNLPLLMIAHNVPYVATASV
GYPHDYIEKLKKAKQVEGFKYIHVLTPDPYGWLFDPSKTAEVAKLAVQTCYWPLFEYYNG
KLSISSESLHCLDRRTRRPIRDFLSVQGRFKRLTEDQIKILEQYIDNVWEKLKSMLDNQ
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
ttgagtttaggactccgagagatattgaataagcataatggtatcttatccgggacttca
gcttgtcccggctgcccagagaatatggcaatgagaatgctaggaatgggactaggtaaa
gatatggttctagtagtagttgcgggatgttcctcagtaatacaaggaaatgcgccttat
aatgcttacaacttccctactgtgaacgttgcctttgcggctggtccagctacggctgct
ggtttggctagagcgtataaacaaagaggtaagaatgtcactgtagtggtttgggctgga
gatggaggaagtgctgatataggatttgcatcattaagcggagctgctgagagaaatgat
aatatactctaccttactgtggataacgaggcctatatgaatagtggagggcagagaagt
ggctcaactccctttggagcaattactactacaactccagagggaaaaaaggaaaataag
aaaaacttgccattattaatgatagcgcataacgtaccttatgtggctactgcatctgta
ggatatccacatgattatatagagaagttaaagaaagccaagcaagtcgaaggtttcaaa
tatattcacgtcctaactcctgatccttacggttggttatttgatccttcaaaaactgct
gaagtggcaaaattggcagtacagacttgctattggcccctctttgaatactataatgga
aaattaagcattagttcagaaagtttacattgtcttgacagaagaactagaagacctata
agagactttctgagtgttcaaggaagattcaagagattgacagaggatcaaataaagatt
ttagagcaatatatagataacgtgtgggagaagttaaaatccatgctcgataatcagtaa

DBGET integrated database retrieval system