KEGG   Streptococcus intermedius B196: SIR_0086Help
Entry
SIR_0086          CDS       T02830                                 

Gene name
adhE
Definition
(RefSeq) bifunctional acetaldehyde-CoA/alcohol dehydrogenase (EC:1.2.1.10)
  KO
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
sib  Streptococcus intermedius B196
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:sib00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    SIR_0086 (adhE)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SIR_0086 (adhE)
   00620 Pyruvate metabolism
    SIR_0086 (adhE)
   00650 Butanoate metabolism
    SIR_0086 (adhE)
  Lipid metabolism
   00071 Fatty acid degradation
    SIR_0086 (adhE)
  Amino acid metabolism
   00350 Tyrosine metabolism
    SIR_0086 (adhE)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SIR_0086 (adhE)
   00626 Naphthalene degradation
    SIR_0086 (adhE)
Enzymes [BR:sib01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     SIR_0086 (adhE)
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     SIR_0086 (adhE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
78275..80926
Genome map
AA seq 883 aa AA seqDB search
MADKKTVAKEDKVLAAQKHVDELVQKGLVALEEMRKLDQEQVDYIVAKASVAALDAHGQL
ALHALEETGRGVFEDKATKNLFACEHVVNNMRHTKTVGIIDEDDVTGLTLIAEPVGVVCG
ITPTTNPTSTAIFKSLISLKTRNPIIFAFHPSAQESSAHAAQIVRDAAIAAGAPENCVQW
ITQPSMEATSALMNHEGIATILATGGNAMVKAAYSCGKPALGVGAGNVPAYVEKSANIRQ
AAHDIVMSKSFDNGMVCASEQAVIIDKEVYNEFLEEFKSYHTYFVNKKEKALLEEFCFGV
KANSKNCAGAKLNPDIVGKSAVWIAEQAGFSVPEDTNILAAECKEVGEKEPLTREKLSPV
IAVLKSESREDGINKARQMVEFHGLGHSAAIHTADEELTKEFGKAVKAIRVICNSPSTFG
GIGDVYNAFLPSLTLGCGSYGRNSVGDNVSAVNLLNIKKVGRRNNNMQWFKVPSKTYFER
NSIQYLQKCRDVERVMIVTDHSMVELGFLDRIIEQLELRRNKVTYQIFAEVEPDPDISTV
MKGTDLMRTFKPDTIIALGGGSPMDAAKVMWLFYEQPEVDFHDLVQKFMDIRKRAFKFPQ
LGRKTKFIGIPTTSGTGSEVTPFAVISDKANNRKYPIADYSLTPTVAIVDPALVLTVPGF
IAADTGMDVLTHATEAYVSQMANDFTDGLALQAIKLVFEHLENSVKNADFHSREKMHNAS
TMAGMAFANAFLGISHSMAHKIGAQFHTIHGRTNAILLPYVIRYNGTRPAKAATWPKYNY
YRADEKYQDIAKLLGLPASTPEEAVESYAKAVYELGERVGIKMNFRDQGIDEKEWKEHSR
ELAFLAYEDQCSPANPRLPMVDHMQEIIEDAYYGYKERPGRRK
NT seq 2652 nt NT seq  +upstreamnt  +downstreamnt
atggctgataaaaaaactgtagcaaaagaagacaaagtcttagctgctcaaaaacacgtg
gatgaacttgttcaaaagggtcttgttgcgcttgaggaaatgcgtaaattagatcaagaa
caagttgattatatcgttgcgaaagcttctgttgctgcgcttgatgcacatggtcaactg
gctttacatgctctagaagaaactgggcgtggtgtttttgaagataaagcaaccaaaaat
ctttttgcttgtgaacatgtggtaaacaatatgcgccataccaaaactgttggaatcatt
gatgaagatgacgtgactggtttgacacttattgcagaaccagtcggcgttgtctgtggg
atcacaccgacaacaaacccaacttcaacagcaattttcaaatcattaatttctttgaaa
acgcgtaatcctattatctttgctttccacccatcagctcaagaatcatctgctcatgcg
gcacaaatcgtgcgtgatgcagcgattgcagcaggtgcgcccgaaaattgtgtacagtgg
attactcaaccatcaatggaagctacttcagcactgatgaaccacgaagggattgcaaca
atccttgcaactggtggaaatgcgatggtgaaagctgcttactcatgtgggaaaccggct
cttggagttggtgctggaaatgtaccagcttatgtcgaaaaatcagctaatatccgccaa
gcagctcatgatattgtgatgtctaaatcatttgataacggaatggtctgtgcttctgag
caagctgttatcattgataaagaagtctacaatgagtttcttgaagagtttaaatcttat
cacacttactttgtcaataagaaagaaaaagctcttttagaagagttctgctttggtgtg
aaagccaacagcaaaaattgcgcaggtgctaaattaaatccagatattgttggtaaatca
gctgtttggattgcggaacaagcaggtttctctgtaccagaagatacaaatattttggct
gcagaatgtaaggaagttggcgaaaaagaaccgttgacacgtgaaaaattatcaccagtc
atcgctgttttgaaatcagaatctcgtgaagacggcattaacaaggctcgtcaaatggtt
gaattccatggacttggtcactcagctgctattcatacagcagatgaagaattgacaaaa
gaatttggtaaagctgtaaaagcgattcgtgtgatttgcaattcaccttctactttcggt
ggtatcggggacgtttacaatgcatttttaccttcattaacattaggatgtggctcttat
ggacgcaactctgttggtgataatgtcagtgctgtaaatctcttgaatatcaaaaaagta
ggaagacgtaataataatatgcaatggtttaaagttccttcaaaaacatacttcgaacgc
aattcaattcaatatctacaaaaatgccgtgatgtagagcgtgtcatgattgtcacagac
cactcaatggttgaattaggattccttgaccgcattattgagcagttagaacttcgtcgc
aataaagtaacctatcaaatctttgcagaggttgaaccagatccagatatttcgaccgta
atgaagggaacagatttgatgcgtaccttcaaaccggatacaattattgctttgggtggt
ggttcaccaatggatgcggcaaaagttatgtggcttttctatgaacaaccagaagtagat
ttccatgaccttgttcaaaaattcatggatattcgtaaacgtgccttcaagttccctcag
cttggcagaaaaacgaaatttatcggtattccgacaacttcaggtacaggttcagaagtt
actccatttgctgttatctctgataaagctaataaccgtaaatacccaattgcagactat
tcattgacgccgacagttgccattgttgatcctgcgctggtattgactgttccaggattt
atcgcagctgatactggtatggacgtattgacacatgcgacagaagcctatgtttctcaa
atggcaaatgactttacagacggtttggcattgcaagcgattaaattagtttttgaacat
cttgaaaattctgtgaagaatgctgatttccactctcgtgaaaagatgcacaatgcttcg
actatggcgggtatggcgtttgccaatgctttccttggaatttctcactcaatggctcac
aagattggtgcacaattccatacaattcatggtcggacaaatgccatcctgttgccgtat
gttattcgctataatggtactcgccctgctaaagcagctacatggcctaagtacaactac
taccgtgctgatgaaaaataccaagatattgctaaattgctcggtcttccagcttctact
ccagaagaagccgttgaatcatatgccaaagcggtttacgaacttggtgagcgtgtagga
attaaaatgaacttccgtgatcaaggaatcgatgagaaagaatggaaagaacattctcgt
gagttagcattcttagcttatgaagatcagtgttcaccagcgaatcctcgtcttccaatg
gttgatcatatgcaagaaattattgaagatgcatattatggatacaaagaacgtccagga
cgtcggaaataa

DBGET integrated database retrieval system