KEGG   Streptococcus intermedius B196: SIR_0479Help
Entry
SIR_0479          CDS       T02830                                 

Gene name
glgB
Definition
glycogen branching enzyme (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
sib  Streptococcus intermedius B196
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sib00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SIR_0479 (glgB)
Enzymes [BR:sib01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     SIR_0479 (glgB)
Exosome [BR:sib04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SIR_0479 (glgB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
467392..469302
Genome map
AA seq 636 aa AA seqDB search
MDRQEALRTFTTGENFHLQHYLGAHQDEVDGQSGYTFRVWAPNAQSVYLIGDFTDWYEHQ
IPMVRNEGGVWEVFTELPQEGDIYKYNIKRSSGQEILKIDPLAVYFEKRPGTGAVVRTLP
EKKWKDGLWLARRKRWGFFSRPVNIYEVHAGSWKKNEDGTPYSFAQLKDDLIPYLVKMNY
THVEFMPLMAHPLGLSWGYQLMGYFALEHTYGTPEEFRDFVEECHINNIGVIVDWVPGHF
TINDDALAYYDGTPTFEYQDHDRAHNYGWGALNFDLGKNEVQSFLISSIKFWIDFYHLDG
IRVDAVSNMLYLDYDSGPWQPNIDGGNRNYEGYYFLQRLNTVIKLAHPDVMMIAEESTSD
TKITGMTEMGGLGFDYKWNMGWMNDILRFYEEDPIYRKYDFNLVTFSFMYAFSENFLLPF
SHDEVVHGKKSLMHKMWGDRYNQFAGLRNLYTYQMCHPGKKLLFMGSEWGQFLEWKCEES
LEWRDLADDMNAKMQHFTSQLNQLYKEHRVLWENDLNWDGLEIIDADNIDQSVLSFIRKN
DKGDMLVCVFNMVPVERKDFTIGVPVAAIYEEIWNTELEEWGGVWKEYNQTVQSQEGLWK
DYPQTLTFTLPALGASIWKIKRRVKSANGSKKSKKE
NT seq 1911 nt NT seq  +upstreamnt  +downstreamnt
atggatagacaagaagcattaagaacttttaccacaggtgaaaatttccatttacagcac
tatttgggagctcatcaagatgaagtagatgggcaaagtggctacacatttcgtgtgtgg
gcaccaaacgctcaaagtgtttatctgattggagactttacggattggtatgaacatcaa
attcccatggtacgtaatgaaggtggcgtatgggaagtatttacagagttacctcaggaa
ggagacatttacaaatataacattaagcgaagtagcggccaagaaattttgaaaattgat
ccgctggcagtttattttgaaaaacgtccgggtacaggagctgttgtgcgaacacttcct
gaaaagaaatggaaagatggcctatggttggcccgcagaaagcgctggggatttttctct
agaccagtaaatatttatgaagttcatgcaggatcttggaagaaaaatgaagacggaact
ccttattcatttgcccaattaaaagatgacctcattccatatctggtcaaaatgaattat
actcatgtggaatttatgccactaatggcacacccacttggcttgagttggggctatcag
ttgatgggatattttgcccttgaacatacatatggaacacctgaggaattccgtgatttt
gtagaagaatgtcatatcaataatatcggagttatcgtagattgggtgcctgggcatttc
acgattaatgatgatgctttggcttattatgatggcacacctacatttgagtatcaagat
catgatcgtgcccataattatggctggggtgctcttaactttgatttaggaaagaatgaa
gtacagtctttcttgatttctagtatcaagttttggatcgacttttatcacttagatgga
atccgtgtggatgcggttagcaatatgctttatctagactatgacagcggcccatggcaa
ccaaatatagacggtggcaatcgcaactacgaaggttattacttccttcaacgcttgaat
actgttatcaagcttgctcatccagatgttatgatgattgcagaagaaagcacgagtgat
acgaagattacgggtatgacggaaatgggtggtcttggatttgactacaagtggaacatg
ggctggatgaatgatattttgcgcttctacgaagaagatccaatttaccgcaagtatgat
tttaatctagtaacctttagtttcatgtacgccttctctgaaaatttcttactgcctttc
tctcatgatgaagtggtgcatggtaagaagagcctcatgcataaaatgtggggagatcgc
tataatcaattcgctggcttacgaaatctctatacatatcaaatgtgtcacccagggaag
aaacttcttttcatgggtagtgaatggggacaatttttagaatggaaatgcgaagaatct
ttggaatggcgtgacttggcggatgatatgaatgccaagatgcagcatttcacttctcag
ctcaatcagctttacaaagaacatcgtgttctatgggaaaatgatttgaattgggatggt
ttagagattatcgatgcggataacattgaccagagtgtactttcctttattcgtaaaaat
gacaaaggagatatgctggtatgtgtatttaatatggttccagtagaacgtaaagacttt
actattggcgttccagtagcagccatatatgaagaaatttggaataccgaattagaagaa
tggggaggtgtatggaaagagtacaatcaaacagttcagtctcaagaaggcttgtggaag
gattatcctcagacgctgacctttactttgccagcattaggggcaagtatttggaaaatt
aaacgtcgtgtgaaatcagcaaatggaagcaaaaagtccaaaaaggagtag

  All links  
No link information was found.   
DBGET integrated database retrieval system