KEGG   Streptococcus intermedius B196: SIR_0857Help
Entry
SIR_0857          CDS       T02830                                 

Gene name
amy
Definition
cytoplasmic alpha-amylase (EC:3.2.1.1)
Orthology
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
sib  Streptococcus intermedius B196
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sib00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SIR_0857 (amy)
Enzymes [BR:sib01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     SIR_0857 (amy)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
871299..872747
Genome map
AA seq 482 aa AA seqDB search
MENQTLMQYFEWYLPNDGQHWNRLARDAPHLASKGIRKVWMPPAFKATSSNDVGYGIYDL
FDLGEFNQKGTVRTKYGLKEEYLKAIKSLKENGIEPIADVVLNHKAAADYKERFTVIEVD
PNDRTVALSEPFEIKGWTKFTFPGRHKKYNDFEWHWYHFTGTDYDAQQNKSGIYLIQGDN
KGWADDDLVDNENGNFDYLMYADLDFKHPEVIQNLYDWADWFIKTTGIHGFRLDAIKHID
SFFMGNFIRDISAKYGDDFYVFGEFWNSDETANNDYLGSIDYRFDLVDVKLHHNLFDASR
AGSGYDLRNIFEQTLVKNHPESAVTFVDNHDTQRGQALESTIEEWFKPAAYALILLREAG
LPCVFYGDYYGVNGEFAQDSFQTVLDKLLDIRLNLAYGEQKDYFDDEHCIAWTRSGKDNG
QPIAVILTNDQANSKRMYVGENWAGKEFKDYLGNNPSTVIIEEDGWANFPVVEKSVSVWS
AK
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atggaaaatcaaacattaatgcaatattttgaatggtatctaccaaatgacggacaacat
tggaatcgcttagcaagagacgccccacatctagcttctaaaggaattcgaaaggtttgg
atgccgcctgctttcaaagcaactagctccaatgatgtcggctacggtatttatgatcta
ttcgacttaggagaatttaaccaaaaaggcaccgttcggacgaagtacggcttaaaagaa
gaatatttgaaagctattaagtcgctcaaagaaaatgggatcgagcctattgcagatgtt
gttttaaatcacaaggcagcagcggattacaaagagcgatttactgttattgaagttgat
ccaaacgatcgtacagttgcactctctgaacctttcgaaattaaaggttggactaaattc
acgttcccaggtcgccacaaaaaatataatgatttcgagtggcattggtatcactttact
gggactgattatgatgctcaacagaataaatcagggatttatctcattcaaggagacaac
aaagggtgggcagatgatgacttagttgataatgaaaatggcaattttgattatctcatg
tatgctgaccttgactttaaacatccagaagtaattcaaaacctttatgattgggcagat
tggttcatcaaaacaacaggcattcatggcttccgactagacgcaattaaacatatcgac
tctttctttatgggaaattttatccgcgacatctcggctaaatacggggacgatttctat
gtctttggagagttttggaatagtgatgaaacagcaaacaacgattatttaggaagtatt
gactatcgttttgatttagtagatgtcaaactacatcataatttgtttgatgctagccgt
gctggatctggctatgatttaagaaatatttttgaacaaactctcgtcaaaaaccaccct
gaatctgcggttacttttgttgataaccatgatacacaacgcggtcaagcgctggaatca
actattgaagagtggtttaaacctgctgcttatgctcttattttattacgcgaagcaggc
cttccttgcgttttctacggagactactatggcgtcaatggggaatttgctcaagacagc
ttccagacagttcttgataaattattagatatccgtctcaacctagcttatggcgaacag
aaagattattttgacgacgagcattgtattgcttggactcgttcaggcaaagacaatgga
cagccaattgctgttattttgacaaatgatcaagcaaattcaaaacgcatgtatgtcggg
gaaaactgggctggcaaagaattcaaagactacttaggaaacaacccttcaactgtgata
atcgaggaagacggctgggcaaatttcccagttgtagaaaaatcagttagcgtctggtct
gcgaaataa

DBGET integrated database retrieval system