KEGG   Streptococcus intermedius B196: SIR_1820Help
Entry
SIR_1820          CDS       T02830                                 

Gene name
malQ
Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
sib  Streptococcus intermedius B196
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:sib00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1906785..1908296)
Genome map
AA seq 503 aa AA seqDB search
MKERQSGVLMHISSLPGKYGIGSFGQSAYDFVDFLVRTKQRYWQILPLGTTSYGDSPYQS
FSAFAGNTHFIDFDRLVEEELLVQSDLEGLDFGQDPRKVDYAKVFNNRRPVLEKAVKRFL
EVDDLAAYEKFVADNSSWLEVFVEYMAIKEYFDLKAWTEWPDAALRRREAASLAHYREKL
ADRLTYHRVTQYLFFKQWLELKAYANEHCIEIVGDMPIYVAADSCDVWAQPHFFKTDELG
QPTCVAGCPPDEFSATGQLWGNPIYDWEAMDKDGYSWWIKRLRESFKIYDVVRIDHFRGF
ESYWEIPAGSDTAAPGKWVKGPDYALFKAVKEELGELNIIAEDLGFMTDEVIALREKTGF
PGMKVIQFAFNPESESIDSPHLAPNNSVMYTGTHDNNTVLGWYRDEIDDATREYMAQYTN
RKEYETVPHAMLRTIFSSVSFMAIATMQDLLELDGSARMNYPSTIGGNWSWRMTADDLDP
VIEAELYSLTKTYRRLNKNLLKK
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgaaagagcgtcaaagtggtgttctcatgcatatttcttctctaccaggaaaatacgga
atcggttcatttgggcaaagtgcttacgattttgtcgattttctggtgagaactaagcaa
cgttactggcaaatattgccgctaggaacaactagttatggagattctccatatcaatct
ttttctgcatttgcgggaaatacacattttattgattttgatcgattggttgaagaagaa
ttgcttgtgcaaagtgatcttgaagggctagactttggtcaagatcccagaaaagtagat
tacgcaaaggtatttaataatcgtaggcctgtgttggaaaaggcggtgaaacgtttctta
gaagttgatgatttagcagcttatgaaaagtttgtggctgacaactcatcatggctcgaa
gtatttgttgaatacatggcgattaaagagtattttgacttgaaagcttggaccgaatgg
ccagatgcggctcttcgacgtcgtgaagcagctagtttagcccattatcgtgaaaaatta
gctgacagattgacttatcatcgtgtaacgcagtatcttttctttaaacaatggttagaa
ttaaaagcgtatgctaatgaacattgcattgaaattgttggcgatatgccaatctatgta
gcagctgatagctgtgatgtttgggcacaaccacacttctttaaaacagatgagctaggg
caacctacatgcgtagcgggatgcccaccagatgaattctctgcgactggccaactctgg
gggaacccaatttatgactgggaagcaatggataaagatggttatagttggtggattaaa
cgcctacgcgaaagcttcaagatttatgatgtagtacgtattgatcatttccgtggattt
gaatcttactgggaaatccctgcgggttctgacacagcagctccgggtaaatgggtaaaa
ggtcctgattatgctttgtttaaagctgtaaaggaagaattgggtgaactaaatattatc
gctgaggatttgggctttatgaccgatgaagtgattgctctgcgtgaaaaaacgggcttc
cctggcatgaaagtcattcaatttgcttttaatccagagtctgaaagtattgatagtcca
catcttgcgcctaataattctgtgatgtacacagggacacatgataacaatactgttctt
ggttggtatcgtgatgaaatcgatgatgctacacgtgaatatatggctcaatataccaat
cgtaaggaatatgaaacagtacctcatgcaatgttacggactattttttcttctgtcagc
tttatggcaattgcaaccatgcaagatttacttgaattagacggttcagctcgcatgaac
tatccatcaactattggtggaaattggtcctggcgtatgacagcagatgatttggatcct
gtgattgaagcagagttatatagcttgacgaaaacatatcgtcgtttaaataaaaattta
ttaaagaaatag

DBGET integrated database retrieval system