KEGG   Sulfolobus islandicus LAL14/1: SiL_0230Help
Entry
SiL_0230          CDS       T02620                                 

Definition
Sugar kinase, ribokinase family
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
sic  Sulfolobus islandicus LAL14/1
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:sic00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    SiL_0230
Enzymes [BR:sic01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     SiL_0230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(196172..196942)
Genome map
AA seq 256 aa AA seqDB search
MTDVLEIMPGGAATNYAVAVTKLGHSAKLLAKVGKSEVVRSLMEKVVELGVGLEYVEELN
EKPSATLIFLRSDGTLSMVRRLGASILLTREDVKRRFGLFDVIHFASVSPNVVVRDPYAK
LVSYDPGPQAKNIESIDVDILYINEKEYEMIEDKNIKARFIVIKMGKKGAKIITETEECS
VEPIQVEKVVDTTGAGDTFDAAFNVTYSEEKDIIKSLQVASVASGLKVTKIGGISSPTLE
EVREYLRKKKPNVICK
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgacggatgttcttgaaatcatgcccggaggagctgcaacaaactatgcagtggcagtg
actaaactgggtcactctgctaaactattagcaaaggttgggaaaagcgaagtagttaga
agtctaatggaaaaagtagtagaattaggggtaggattagaatacgtagaggaattaaac
gagaaacctagtgcaacactaatcttcttgagaagtgatggaacactatctatggtaaga
agacttggcgcatcaatattgctaacaagagaagatgtaaaaaggcgttttggactgttt
gacgttattcacttcgcctcagtatcaccaaacgttgttgtgagagatccttatgcaaaa
ttagtaagctatgatcctggcccacaagctaaaaatatagagtcgattgacgtagacatc
ttatatattaatgaaaaagagtatgaaatgatagaagataagaacataaaggccagattt
atcgtcattaagatgggcaagaaaggggcaaagataattactgagactgaagagtgttca
gttgaaccaatacaagtagaaaaggtagttgatactactggagctggagatacctttgat
gcagcatttaatgtaacatattctgaggaaaaggatattataaagagtctacaagttgct
agcgttgcatctggtcttaaggttacgaagataggaggaatttcttcaccaacattagaa
gaggtaagagagtatttaaggaaaaagaaaccaaatgttatatgtaaatga

DBGET integrated database retrieval system