KEGG   Sulfolobus islandicus LAL14/1: SiL_0911Help
Entry
SiL_0911          CDS       T02620                                 

Definition
Isocitrate lyase
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
sic  Sulfolobus islandicus LAL14/1
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:sic01200]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:sic00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
869155..870468
Genome map
AA seq 437 aa AA seqDB search
MNIRDKWSEEEKRLEYEWSEDPRWKGIKRNYKPSDVVKLRGSIRIEYSIAKLASHKLWNL
LNTEPYIATFGALTGSQAVEMAKAGLKAIYVSGWQVAADNNLSNQTYPDLSLYPSNSVPN
LVKRLNNALLRADQISWSEGKRDIDYLLPIVADAEAGFGGPIHAFELTKALIEAGAAGVH
FEDQLAAEKKCGHLGGKVLIPISAFIRVLNAARLASDVLGVPTILIARTDALNAKYLSND
VDETDNQFLTGKRTSEGYYEIRGGIEYAIARGLAYAPYADLLWFETSKPDLEEARQFAEA
IHTHYPGKLLAYNLSPSFNWKKFMDDSKISRFMNELGEMGYKFQFITLAGWHLINYHTFK
LARAYRNEGMPAYVRLQESEFQAQAEGYTAVSHQREVGTDYFDLVLTIASGGEASTTAME
GSTEAEQFVEAKQKVLK
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atgaacatccgagataaatggagtgaagaggaaaaaagacttgaatacgagtggtccgaa
gatccaaggtggaaaggaataaagagaaattataagccctcggatgtggtaaaattaagg
ggatctatcagaattgagtatagtatagctaaattagcctcacataaactttggaacttg
ctaaatactgagccctatatagcaacatttggggcattaacgggttcccaagcagttgaa
atggcaaaagctggccttaaagcaatttacgtaagtggatggcaagtagctgctgataac
aatttatcaaatcaaacttatccagacttgagcttatatccatctaacagtgttccaaac
ttagtaaagaggttaaataacgctcttttaagggctgaccaaatatcttggagtgagggt
aaacgcgatatcgattacttactgcctattgttgcagatgctgaagctggtttcggtggt
ccaattcacgctttcgaactaacaaaagccttaatagaggcaggggctgcaggcgtacat
tttgaagatcaattagcagcggagaaaaaatgtggacatttaggaggaaaagttctaatt
ccaataagtgcatttataagagtactaaacgctgcaagactagcatctgacgtattagga
gtacccacaatactaatagcaaggacagacgcactaaatgcgaaatacttatctaacgat
gtagatgagactgataatcaatttttaactggaaaaagaacatcagagggatattatgag
attaggggaggtatcgaatacgctattgccagaggattagcttatgcaccctatgcggac
ctattatggtttgagacttctaagccagatttggaagaggctagacaatttgcagaggct
atccacactcattaccccggtaagttgttagcgtataacctatccccctcatttaactgg
aagaaatttatggatgattccaaaatcagtaggttcatgaacgaattaggagaaatgggc
tataaattccaattcataacccttgcaggttggcacttaattaactaccatacattcaaa
ttggcgagagcatatagaaacgaaggaatgccagcatatgtaagactacaggagtcagag
ttccaggctcaagcagaaggatatacggccgtaagtcatcagagagaggttggaacagat
tacttcgacctagtgttaacaatagcatctgggggagaagcgtccactactgcaatggaa
ggttctactgaagctgaacagtttgtagaggcaaaacagaaagtattgaaataa

DBGET integrated database retrieval system