KEGG   Sulfolobus islandicus LAL14/1: SiL_1805Help
Entry
SiL_1805          CDS       T02620                                 

Definition
(GenBank) Uroporphyrinogen-III synthase
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
sic  Sulfolobus islandicus LAL14/1
Pathway
sic00860  Porphyrin and chlorophyll metabolism
sic01100  Metabolic pathways
sic01110  Biosynthesis of secondary metabolites
sic01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sic00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    SiL_1805
Enzymes [BR:sic01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     SiL_1805
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4
Motif
Other DBs
NCBI-ProteinID: AGJ63251
UniProt: M9UF64
Position
complement(1660715..1661419)
Genome map
AA seq 234 aa AA seqDB search
MRILFLRPDNEDTELNEKLMLLQKNGIEVLNIPIFKIKCIPYSLPNYDYEALAFTSRNSV
ICFKEHFLIKNRKIYAIGEETSELLMRMYNTNPITPEKFTSVELARRILEDKVNSVLSIR
SKKASEDMKNLLNGKIKYDEIYVYDSEIIRDNINKVSKILAKCEVDAIAFTSSLMARLIG
PYISRKCKIIVYSIGPITTETLKRVNNEVKIIESKTHSIKGIIETILVEMKRNG
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atgaggatattattccttaggcccgataacgaagacacggagctcaatgaaaagcttatg
ctccttcagaaaaatggaattgaggttctaaacatacccatttttaaaataaaatgtatc
ccgtattcattaccgaactatgattatgaggcccttgcatttacaagtagaaattcagtt
atttgttttaaagaacatttcctcattaaaaatcgtaagatatacgccataggagaagaa
acttcagagttactaatgagaatgtacaatacaaatccaataactccagagaaatttaca
agcgtagaactagctagaagaatcttggaagataaggtaaatagtgtgctcagcataagg
agtaaaaaagcttctgaagatatgaaaaatcttcttaatggcaaaattaaatatgatgag
atctatgtatatgattcggaaataattagagataatataaataaagtgtcaaaaatccta
gctaaatgtgaagtcgatgccatagcatttactagctcattgatggcaaggctaattggc
ccttatattagtagaaagtgtaagattatagtatatagcataggtccgattacgacggaa
actttgaaacgggttaataatgaggtaaaaataatagaaagtaagacacattctatcaaa
ggcattatagaaactattttggtggagatgaaacgaaatggatga

DBGET integrated database retrieval system