KEGG   Sulfolobus islandicus M.16.4: M164_0174Help
Entry
M164_0174         CDS       T00906                                 

Gene name
sdhA
Definition
succinate dehydrogenase flavoprotein subunit (EC:1.3.99.1)
Orthology
K00239  
succinate dehydrogenase flavoprotein subunit [EC:1.3.99.1]
Organism
sid  Sulfolobus islandicus M.16.4
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Dicarboxylate-hydroxybutyrate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:sid01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:sid00020]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:sid00650]
Metabolism; Energy metabolism; Oxidative phosphorylation [PATH:sid00190]
Metabolism; Energy metabolism; Carbon fixation pathways in prokaryotes [PATH:sid00720]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
147375..149075
Genome map
AA seq 566 aa AA seqDB search
MEKIEYDAVVIGGGLAGLMSAHEIASAGFKVAVISKVFPTRSHSAAAEGGIAAYIPGNSD
PNDNPDYMTYDTVKGGDYLVDQDAAELLSNKSGEIVMLLERWGALFNRQPDGRVAVRYFG
GQTYPRTRFVGDKTGMALLHTLFERTSGLNVDFYNEWFSLDLVTDNKKVVGIVAMQMKTL
TPFFFKTKAVVLATGGMGMLYRHTTNSYINTGDGFGIALRAGAALKDPEFVQFHPTALYP
SDVLISEAARGEGGILKNVKGERFMTKYAPKKLDLAPRDIVSRAIITEIREGRGFPGGYV
GLDLTHLGEEYIKERLALAVEAAKSFASVDAFTEPIPVRPAQHYYMGGIDVDIDGRNPDI
VGLFSAGEAACVSVHGANRLGSNSLLDTLVFGQVTGRTVVQFLKSNPGNPTSNYEKEAEK
VVDDAYKFVKSESGVHFGQILEKLRDTMWDYVGIYRDEGGLLNAMSEINKLRGMISNMYV
TDKSKVYNTEFFNALELRNMLDLALTITKSALERKESRGAHYRTDYPDRDDNNWLKHTIA
YLRGNTVEVTFKPVKITRWKPEPRVY
NT seq 1701 nt NT seq  +upstreamnt  +downstreamnt
atggaaaagatcgaatacgatgcagttgtaattggaggaggactagctggcttaatgagt
gcgcacgagatagcctctgctggctttaaagttgctgttatttcaaaggtgtttcccaca
aggtcacactctgctgctgcagaaggtggaatagctgcctacattcccggcaattcagat
ccaaatgataacccagattatatgacatatgatacagttaaaggaggagattatttagta
gatcaagacgcggcagagttactttctaacaaatccggagaaatagtaatgctactggaa
agatggggggctctattcaataggcaacctgatggcagagtcgcagttagatattttgga
ggacagacctatccgaggactagatttgtgggagataaaacaggtatggcgcttttgcat
acgctttttgaaaggacttccggtctaaatgtggatttttacaacgagtggttctcctta
gacttagttactgataataaaaaggtagttggtatagtagcaatgcaaatgaagacgctg
actccattcttctttaagacaaaggctgtcgtattggcaactggaggaatggggatgctg
tataggcatacaaccaatagttacattaacactggtgatggcttcggaattgcattaaga
gcgggagctgcgttaaaagatccagaatttgtgcaatttcatcccacagcattataccca
tcagacgttcttattagtgaagccgctagaggagaaggtgggatactgaaaaatgttaaa
ggagaaagatttatgacgaaatatgctcccaaaaagctagatctagcgcctagggatata
gtttcaagagcaatcatcaccgagataagggaaggaagagggttccctggtggatatgtt
ggcttagatttgactcatttaggtgaagaatatattaaagaaaggttagctttagctgta
gaagctgcaaaaagttttgcaagtgttgatgcgtttactgagcctattccagtcaggccc
gctcagcattattatatgggaggaatagatgtggatatagatgggaggaatccggatatt
gtgggattattctctgcaggtgaagcagcttgtgtatcagtacatggggctaatagatta
ggctcaaattcacttctggacactttagtatttggccaagttacaggtagaactgttgta
caatttcttaagtctaatccaggtaaccccacatcaaattatgagaaagaggctgagaaa
gttgttgatgacgcttacaagttcgtaaagagcgagagtggtgtacattttggccaaata
ttagaaaagctaagagatacaatgtgggattatgttggaatatatagagatgagggtggt
ctactaaatgcaatgtccgagataaataaattaagaggtatgattagtaatatgtatgtt
acagataagagtaaagtctataatacagaattctttaacgctcttgaattaaggaatatg
ttagatttagcattaactataaccaagtcagctttagagaggaaagagtcaagaggggct
cattataggacggattatccagatagagatgataataattggttgaaacacacgattgcg
tatttaaggggtaatacggttgaagtcacatttaaaccagttaaaataaccagatggaag
ccagaacctagggtgtattaa

DBGET integrated database retrieval system