KEGG   Sulfolobus islandicus M.16.4: M164_0412Help
Entry
M164_0412         CDS       T00906                                 

Definition
alcohol dehydrogenase GroES
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
sid  Sulfolobus islandicus M.16.4
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Class
Metabolism; Overview; Degradation of aromatic compounds [PATH:sid01220]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:sid00010]
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:sid00071]
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:sid00350]
Metabolism; Xenobiotics biodegradation and metabolism; Chloroalkane and chloroalkene degradation [PATH:sid00625]
Metabolism; Xenobiotics biodegradation and metabolism; Naphthalene degradation [PATH:sid00626]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
349009..350094
Genome map
AA seq 361 aa AA seqDB search
MKAARLVEFQKPLKIEDLEVPKVGKGDVLLKVISCGICRSDWHLWRGDPALVAYMQWSGG
KLPITQGHEVYGEVVEVGESVAKLKKGDKVVMPASSTGDNRTCKYCMEGDSNVCDHLVIA
GYGINGCFAEYMLVPERSVIDLVKVPDGIKPEWAALSSCGFGTSWNAFTMKTNLKPGDMV
LTIGAGGMGLSGIVIANALGAKVIAVDVNERSLEKAKILGSIETYKYSGKSEELNEIVED
IMRKYGSVDVVYDTTGIPEAVIPFLPLLRVHGTLLLAGLMMKGKETFPLPADLVVAREIR
IQGVLMLPAQKFDTIFKLMKEGKINLDPVTYKTISIYDVNDAYKEMSEYKNAGRIIINKF
S
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcagctagattagtggaatttcaaaagcctctgaagatagaggatctcgaagtt
cctaaagttggaaaaggagatgtacttctaaaagtgataagctgtggaatatgtagatca
gattggcatctatggcgtggagatcctgctttggtagcatatatgcagtggagtggtggt
aagttaccaataactcaaggtcatgaggtttatggagaagtcgtagaggtcggagagagt
gtagctaaattgaaaaagggagataaggtagtcatgcctgcttcttctaccggagataat
aggacatgcaaatactgtatggaaggagattcgaatgtttgtgatcacttggtaatagct
ggttatggaattaatgggtgctttgctgagtacatgttagtcccagagaggtcagtaatt
gatctagttaaagtaccagatggaataaagccagagtgggctgctctaagttcttgtggt
tttggaacttcatggaacgcgtttacaatgaagactaatttaaagcccggtgacatggtg
ctcacaatcggagcaggagggatgggtttgagtggtatagtaatagctaacgctcttggt
gctaaagtaatagctgtagacgttaacgaacgatctttagagaaagctaaaatattaggt
agcattgagacttataaatattctggtaagtctgaagaattgaatgaaatagtagaggat
attatgaggaagtatggttcagtggacgtagtgtatgatactacaggaattccagaggct
gtcataccgtttttacctctccttagagtgcatgggacattactattagcggggcttatg
atgaaggggaaagagacttttccattgccagcagatttagtggtagcaagggaaatcaga
atacaaggagtattaatgttaccagctcaaaaattcgatacaatatttaaattaatgaaa
gaaggaaagattaatctagatccagttacgtacaagactataagcatctatgatgtcaat
gatgcctacaaggaaatgagcgagtacaaaaatgcaggaagaattattattaataagttt
agctaa

DBGET integrated database retrieval system