KEGG   Sulfolobus islandicus M.16.4: M164_0539Help
Entry
M164_0539         CDS       T00906                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
sid  Sulfolobus islandicus M.16.4
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sid00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    M164_0539
Enzymes [BR:sid01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     M164_0539
Exosome [BR:sid04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   M164_0539
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(468515..470020)
Genome map
AA seq 501 aa AA seqDB search
MNTMSHKFVLALDEGTTSARAILFDSDLNIVNIGQYEFPQHYPQPGYVEHDPEEIWEAQM
LAVKKAISKIDAKQIVAIGITNQRETTVLWDAKSGKPVYNAIVWQDRRTSPITDWLKANY
FKMIKDKTGLVPDPYFSASKIKWILDNVSNVREKAERGEIKFGTIDTYLIWRLTNGKAHV
TDYSNASRTMLFNINKLEWDREILELLKIPESILPEVKPSSEIYGYSEALGNLIPISGDA
GDQQAALFGQVAFNVGEIKATYGTGSFILMNIGNNPIRSENLLTTIAWGLEKNKAKYALE
GSIFITGAAVQWFRDGLRAIDVSDEIEPLASSVEDNGGVYFVPAFVGLGAPYWDPYARGL
IIGITRGTTKAHIARAILESMAYQTRDVIEVMQKEAGISINSLKVDGGAAKDNLLMQFQA
DILGIKVIRPKVMETTSMGVAMLAGLGVGLWNSLEELRNIWKVDKEFIPSMSEEKRRALY
SGWKEAVKRAMGWAKVVGGQV
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgaatactatgtcacataagtttgttctagccctagatgagggtactacaagtgctagg
gctatactcttcgatagtgacttaaacatagtaaacatagggcaatatgaattcccgcag
cactatcctcaacctggctatgtggaacatgaccctgaggaaatatgggaagctcaaatg
ttagccgtaaaaaaggctataagtaaaatagatgctaaacaaatagtagcaatagggata
acaaaccaaagggagacaacggtattatgggatgctaaaagcggtaaaccggtttacaat
gcaattgtatggcaggatagaagaacttctccaataacggactggctaaaagcaaattac
tttaaaatgataaaggacaaaactgggttagttccagacccttactttagtgcatctaag
ataaagtggatacttgataatgtgtccaatgttagggagaaagcagaaagaggagaaatt
aagttcgggaccatagatacttatttaatctggaggcttactaatggaaaagctcatgta
actgattactctaacgcttctagaacaatgctttttaatataaataaattagaatgggat
agagaaatcttagaacttctaaaaatacccgaatctatattgccagaggttaaaccatca
agtgaaatttacggttacagtgaggcgttaggaaacttaatacctatatctggggacgca
ggagaccaacaagcagctttattcggtcaggtagcgtttaacgtaggtgagataaaagct
acttatggtaccggtagtttcattttaatgaatataggcaataacccaatacgatcagaa
aacctcttaactacaatagcttggggtcttgagaagaataaggcaaagtatgcattagag
gggagtatattcataactggtgcagctgtacaatggtttagggacggcttacgggcaata
gacgtttcagatgagattgaacctttagcctcaagtgtggaagataatggcggtgtctat
ttcgttccagcttttgttggattgggagctccttactgggatccatatgctagaggtctc
ataataggcataactagaggaactactaaagctcatatagctagggctattttagaatca
atggcctatcaaactagagatgtaattgaggtaatgcaaaaggaagccggcatcagtata
aattcgcttaaggttgacggaggtgcagctaaggataaccttttaatgcaattccaagct
gatatattaggtattaaggtaatcagacctaaagttatggaaactacttctatgggagtt
gcaatgttagcaggtttaggtgtaggcttatggaactctttagaggaattaaggaacata
tggaaggttgataaggaattcattccaagtatgagtgaggagaaaaggagggcattgtac
tctgggtggaaggaggctgtaaagagagctatgggatgggctaaagttgtaggaggtcaa
gtttaa

DBGET integrated database retrieval system