KEGG   Sulfolobus islandicus M.16.4: M164_0543Help
Entry
M164_0543         CDS       T00906                                 

Definition
medium-chain-fatty-acid--CoA ligase (AlkK-1)
Orthology
K14466  
4-hydroxybutyrate---CoA ligase (AMP-forming) [EC:6.2.1.40]
Organism
sid  Sulfolobus islandicus M.16.4
Pathway
Carbon fixation pathways in prokaryotes
Microbial metabolism in diverse environments
Carbon metabolism
Module
Dicarboxylate-hydroxybutyrate cycle
Hydroxypropionate-hydroxybutylate cycle
Brite
KEGG Orthology (KO) [BR:sid00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    M164_0543
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    M164_0543
Enzymes [BR:sid01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.40  4-hydroxybutyrate---CoA ligase
     M164_0543
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(475371..476795)
Genome map
AA seq 474 aa AA seqDB search
MSAVKNEYDAIHRELREQGFIRTDYPPNPSEVLWNKKIMTMKREEIDKLKTFRLRRIIKW
AWENIEFYRRFWKSKNFEPDMIKDWRDIAKIPILRKDEIRKDLQQNPPFGTIFHPELANH
IRFVGATSGSTGLPTFQGWGALEMDYFQEAQARYLWTFAEVKPTKVYANYLNMSGFYSWG
PPVVETAMWRCGATVIAGGGETYFSWKNRHNLIFKLWKVDVFATTPWLHRLVGEEAKIEG
WETPFKVLLLHGGAAAENTKKKLFKVHPNAELAISVWGTTDGHMAIEVPSLEGQLVVWED
MEIFDIVDPKTDEPVSGGERGELIATLLNHFTMPLIRYSLGDYVKNDFLTDPDPKYGITH
MRFAEPIPGRVEWMFFVKGKLLLPIYVEDAVNEIPDTTGMFNIFIYDNSMDKLKIRIETR
REQVNSTYDKQAREILASRIGINPDDVEIEWVKPGNTIWTGYKLQVFVDQRKKK
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcagttaaaaacgaatacgatgcaattcatagggaattgcgagaacaaggtttt
attagaactgattatcccccaaatccatctgaagtgttatggaataagaagataatgaca
atgaaaagagaggaaatcgataagttaaagacgtttagactaaggaggattataaagtgg
gcatgggaaaacattgagttctatagaaggttttggaagtctaaaaacttcgaaccagac
atgataaaggactggagggatatcgctaaaataccgatattgagaaaagatgaaattagg
aaagacctacagcaaaatcctccatttggtacaattttccatccagaattggctaatcac
ataagatttgttggagcaacttctggctcaactggattacctactttccaaggatggggg
gctttggaaatggactacttccaagaagcccaggcaaggtacttgtggacttttgccgaa
gttaagccaactaaggtttacgcgaactacctaaacatgagtggcttttatagttggggg
cctccggttgttgagaccgcaatgtggagatgtggggcaactgtcatagctggaggtggt
gagacttacttctcatggaagaatagacacaacttgatcttcaaactatggaaagttgac
gtattcgccacaactccttggctacatagattagtaggagaggaggctaaaattgagggt
tgggaaactcctttcaaggttttgctacttcacggcggtgcagctgctgaaaacactaaa
aagaaattattcaaggttcatccaaatgctgaattggctataagtgtttggggaaccact
gatggacatatggctattgaagttccaagcttagaaggacaattagtagtttgggaggac
atggagatatttgatattgtagaccctaagactgatgaaccagtatctgggggagaaaga
ggtgaactgatagcgaccttgttaaatcactttaccatgcctttaatacgctatagttta
ggagattacgttaagaatgacttcctgaccgatccggatcctaagtatggtataactcac
atgagatttgctgagccaataccaggtagggttgagtggatgttcttcgttaaagggaaa
ctattattgccaatttacgttgaggacgctgtgaatgaaattccagacactactggaatg
tttaacatttttatttacgataatagtatggataaattgaagattagaatagagacaagg
agggaacaggttaattctacttacgataagcaagccagagagatattagcgagcaggatt
gggattaacccagatgacgttgagatagagtgggtaaagcctggaaacacaatatggaca
ggctacaagttgcaagtgtttgtcgaccagaggaagaaaaaataa

DBGET integrated database retrieval system