KEGG   Sulfolobus islandicus M.16.4: M164_0605Help
Entry
M164_0605         CDS       T00906                                 

Definition
succinyl-diaminopimelate desuccinylase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
sid  Sulfolobus islandicus M.16.4
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:sid01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:sid00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(544436..545647)
Genome map
AA seq 403 aa AA seqDB search
MILDEIVEASKDEIVEFLKQLIRIPTENPPGLNYDKIISVLRDKLEEFGYKTEIIEGNKE
FVKFGNGNRPNLVGYLGNGNVRIAFNGHYDVVPAGEGWSINPYEGIEKDGKVYGRGASDM
KSGIVAQIYAVEMLKRAKLLPSNVKIIQTIVPDEETVGNKNAGTYCLREIYKKNADYVIF
TEPTGPDNICNGHRGAIWAVVKVYGKKSHGGFPQLGIDAVKAVAIMIERLYSSLSNITSK
YNIVPEAGKKPSILVGTVKCGTWVNTVADYCEFSIVRRLIPEERIDEVRESILRLLREVS
NETGVKFDYDEFYAVDTVVSEDGRLIDALRKAIREVRGVDPNVVLSAGTFDIRFTVSEGI
KSINYGPGRIELAHSTDEFVYVKDLLDSIKALGRVLLEVAKGS
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgatattagatgagatcgttgaagcctctaaggatgaaattgtggagttcttaaagcag
ttaataaggatcccaactgagaatcctcccggcttaaattacgataagataattagcgtg
ttgagggataaattagaagagtttgggtataaaacggaaattattgagggtaataaagag
tttgtcaagttcggaaatggcaatagaccaaatctagtaggttatttgggtaatggcaac
gtaaggattgcgtttaatggacattacgatgttgttcccgccggtgagggatggagtatt
aacccttatgaggggattgaaaaagatggcaaggtttacggaagaggagcttctgacatg
aagtctggaatagttgcacaaatttacgctgttgaaatgttaaagagagctaaactactc
ccctctaacgtgaaaatcatccagaccattgtcccagatgaggagactgtaggcaataaa
aatgctggtacttattgtttaagggaaatctacaagaagaacgccgattacgtaatattc
acagaacctactggaccagataacatttgtaatggtcataggggtgcaatctgggctgtg
gttaaagtatatgggaagaaaagtcatggaggttttcctcaattaggaattgacgcagtc
aaggctgtagcgattatgattgaaagactttactcgtctttatccaacattacctcaaag
tacaacattgtaccagaggctggtaagaaaccgtcaatattagttggtactgttaagtgt
ggtacgtgggttaacactgtagcagactactgtgagttcagtatagttaggagattaatc
ccagaggagaggattgatgaggttagggagagcattttacggttgttaagggaggtgagt
aatgagactggcgttaagtttgattacgatgagttttacgctgtcgatactgtagtaagt
gaggatgggagactgatagatgctctgagaaaggctataagggaggtgaggggagttgat
cccaatgttgttttatctgcagggactttcgatattaggtttaccgtaagtgaggggata
aagagtattaattacggtccgggtaggattgagttagcacattctacagatgagttcgtt
tacgttaaagatttattggattcaataaaagcgttaggaagagtactattggaggtggct
aaaggaagttag

DBGET integrated database retrieval system