KEGG   Sulfolobus islandicus M.16.4: M164_0669Help
Entry
M164_0669         CDS       T00906                                 

Definition
nucleotidyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
sid  Sulfolobus islandicus M.16.4
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sid00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    M164_0669
   00052 Galactose metabolism
    M164_0669
   00500 Starch and sucrose metabolism
    M164_0669
   00520 Amino sugar and nucleotide sugar metabolism
    M164_0669
Enzymes [BR:sid01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     M164_0669
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
611777..612529
Genome map
AA seq 250 aa AA seqDB search
MHAVITAAGLGTRMLPASKEIPKEMFPIPFNNGFKPIIQIIFEQLYNKGIRDFVIVVGRG
KRVIEDHFTPDYDFVSYLEKVGKEKQARELLTFYSKIEKSNIAFVNQPEPKGFGDAVLRV
EPFINDKFIVVAADTLLREIPDLIPNSFLVTEVEDPRPYGVVILEGDRVIDVEEKPKNPK
SRFIIVPYYMFTYDIFHALREVKCNGELQLTEGIKILLKKGVEFIAKRVNDVYDLGSIEN
YIASIKKIIG
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgcatgcagtaataactgcagctggattaggcactcgaatgttacccgcttctaaagaa
attcctaaggagatgtttccaattccctttaacaatggatttaagccaattatacaaata
atctttgagcaactttataacaagggtataagggatttcgttatagttgttggtaggggt
aagagggtaattgaagatcattttacaccagattacgattttgtctcttaccttgaaaaa
gtaggtaaagaaaagcaggcaagggagttattaacattttactctaaaatagagaaaagc
aatatagcatttgtaaatcagcctgaaccaaaaggatttggagatgcggtactgagagta
gaaccttttattaatgataaattcattgtagtagcagcagacactctattaagagagatt
ccagatttaatacctaactcttttctagttactgaagtagaagatcctagaccatatggt
gtagtaatattagagggagatagagttatagatgtcgaggaaaaacctaagaatcctaaa
tcccgttttataatagttccttactatatgtttacatatgatatatttcacgccttaaga
gaagttaagtgtaacggagaattacaacttactgaagggataaaaatattgctgaaaaaa
ggtgtggaatttattgcaaaaagagtaaatgatgtttatgatctgggtagtatagagaat
tatattgcatccataaagaaaattattggataa

DBGET integrated database retrieval system