KEGG   Sulfolobus islandicus M.16.4: M164_0684Help
Entry
M164_0684         CDS       T00906                                 

Definition
(RefSeq) malate synthase
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
sid  Sulfolobus islandicus M.16.4
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:sid00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    M164_0684
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    M164_0684
   00630 Glyoxylate and dicarboxylate metabolism
    M164_0684
Enzymes [BR:sid01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     M164_0684
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(630355..632835)
Genome map
AA seq 826 aa AA seqDB search
MSFGLKISEEVYQKYSDLFGEKTINDRIVSVEKLIEELAVEFSDEIRRVINKRRQWLESK
DPVTSKGAFPSFDEVFVDADGNKRTFREIIQGMIDNFLGVQSKLRWRLNENVPIPKDAHP
LNNPGLEITGPWYPLSRAYNQINSDVACVMEDEEDASPAWYIPFGSGKTTADVWEGRKNV
KLFLSGKAPNPYYEKGKTYSLNKPRDKWPVIFHRLPGLHLLDFDITLNGKPVPAIIVSAV
IYTLNNYNSLKSAGSGVYFYLPKTQTPDEALVIEKILRRIESKLGLKIGTLKIALLYEEV
NAGRFFPIILWIFRERLIKSNNGRWDYLGSLIEMWLQEKVLPDPQNITMTSPNMMAYQKY
NALMMLLAGAKNGEADSAPVGGMAAVMLYPQTDPFGRNRYNLKALRGMKLDKLRERLIGL
IFVAEDKVEGKVTLEEVINGKVKGKLYDMFRQSWVATKEEAYVEAGSKPLRVSLEELQKI
IDAPVNYIEVEGTKLPTVDSGLTPEERALFQKLGLINERGKITPWVITKEMINTPEKLLF
NKELWGGKDLWHSLYDIPEGDITPEHVQHAFYMAANYGFQLLNGNLAAAIDDYELKQRFM
NDLATYRIFTSWLWSVINRDASFTKDGYIKGPKLTKDGVIPAEDVLKVTKGTKIKDIFEK
LWELHLDWTYEFYKEQDMRAARKIAETFGKTNNTSTVEEVYKVVSEAYRSGPFREMSAKE
AAQKLAKILNADASEIEEELINLAPRFDRAMAPVIMEILMKQMLYPKYIMNSGKILFILS
PLDPERRSKVMDSIFSFRKMVEDKVRRGELDKWVLELYDYVYDNYW
NT seq 2481 nt NT seq  +upstreamnt  +downstreamnt
atgtcttttggccttaaaatctctgaagaggtatatcaaaagtatagtgacctcttcgga
gaaaagaccataaacgataggattgtaagtgtcgaaaaactcattgaagagcttgcagtt
gagttctcggatgagataagaagggttattaataaaaggagacaatggttagaatcaaaa
gatcccgtgacctctaagggtgctttcccatccttcgacgaagtttttgtagacgctgat
ggaaataagagaacctttagggaaatcattcaagggatgatagacaatttcctaggagta
cagtcgaagctgaggtggaggttaaatgaaaatgtacctataccaaaagacgcacacccc
cttaataacccgggattagaaatcactggaccttggtatcctctaagtagggcatataat
caaataaattcagacgtggcatgtgttatggaagatgaggaagatgcctcacccgcatgg
tatattccctttggttctggtaaaacaactgctgacgtatgggagggaagaaagaacgta
aaactctttctctccggtaaggctccaaatccttactacgagaaggggaaaacgtatagc
ctaaacaaacctagagataagtggcctgtgatttttcacagacttcctggattgcacctc
ttggattttgacataacgctaaatggtaaaccagtaccggctataattgtttctgccgtc
atatataccctaaataattacaatagcctaaagagcgcaggctctggggtatatttctat
ctgcctaaaacacagacaccggatgaggcattggtaatagaaaagatcttgagaagaatt
gagtctaaactagggcttaagataggtacacttaagatcgctctcctttacgaagaggtt
aatgcgggaagatttttccctataatactgtggatatttcgtgagaggctcattaaatca
aataacggtagatgggactacttgggaagtttaattgagatgtggttacaagagaaagta
cttcccgatccccaaaacattaccatgacctcaccaaacatgatggcttatcaaaagtat
aacgcacttatgatgctattggctggggcaaagaatggtgaagccgattcagctccagta
ggtggtatggcagcagtaatgctttatcctcaaactgatccgttcgggagaaatagatac
aacttaaaggcattaaggggaatgaagttagataagttaagagagaggctaatagggctt
atttttgtagcagaggataaagttgaaggtaaagttactttagaggaggtaattaatggc
aaagtaaagggtaaactttatgatatgtttagacagagttgggttgcaaccaaggaagag
gcttacgtagaggctgggagtaaacctttaagggtaagcctagaggaattacagaaaata
attgatgcaccagttaactatattgaagtagagggaaccaaattacctactgtggatagt
ggactaacaccagaggaaagagcattattccaaaaacttggtctaattaatgaaagagga
aaaataacaccttgggttataactaaggaaatgattaacactcccgaaaagttactattt
aataaggaattatggggtggaaaagacctatggcattcgttatatgacatcccagaggga
gacattacaccggagcatgttcaacacgcattctatatggcagcaaattatggtttccaa
ttgcttaatggtaacttagctgcagcaatagatgattatgaattaaagcaaagattcatg
aatgatctagctacctatagaatattcacttcttggctatggagtgtgataaatagagac
gctagcttcacaaaggatggatatattaagggaccaaagttaactaaggacggtgtaatt
ccagctgaagatgttctaaaggttacaaaggggactaagataaaggacatattcgagaag
ttatgggagttacacttagattggacatatgagttttacaaagaacaagatatgagagca
gctaggaaaatagcggaaacctttggaaagacaaataatacttccacagtagaagaggta
tataaggtagtttccgaggcttataggtcaggtccgtttagagaaatgtcggctaaagaa
gctgcacagaagttggcaaaaattcttaacgctgacgcctctgagatcgaggaagagctt
attaatttagccccaaggtttgacagagctatggctccagtaataatggaaattttaatg
aaacagatgctatatcctaagtacattatgaatagtgggaagattctcttcatactatcg
ccgttagatccagagaggaggtcaaaggtcatggatagtatattctcgtttagaaaaatg
gttgaagataaggtaagaagaggggaactagataagtgggtattggagttatatgactac
gtttatgataattactggtaa

DBGET integrated database retrieval system