KEGG   Sulfolobus islandicus M.16.4: M164_0732Help
Entry
M164_0732         CDS       T00906                                 

Definition
(GenBank) AMP-dependent synthetase and ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
sid  Sulfolobus islandicus M.16.4
Pathway
sid00010  Glycolysis / Gluconeogenesis
sid00620  Pyruvate metabolism
sid00640  Propanoate metabolism
sid00680  Methane metabolism
sid00720  Carbon fixation pathways in prokaryotes
sid01100  Metabolic pathways
sid01110  Biosynthesis of secondary metabolites
sid01120  Microbial metabolism in diverse environments
sid01130  Biosynthesis of antibiotics
sid01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sid00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    M164_0732
   00620 Pyruvate metabolism
    M164_0732
   00640 Propanoate metabolism
    M164_0732
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    M164_0732
   00680 Methane metabolism
    M164_0732
Enzymes [BR:sid01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     M164_0732
Lipid biosynthesis proteins [BR:sid01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   M164_0732
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: ACR41349
JGI: SislK30732
UniProt: C4KFD3
Position
complement(680285..681781)
Genome map
AA seq 498 aa AA seqDB search
MASYEEVRRSFSWSEVIRYLDKNPLDVLTSNDGIAVRRFTKNAMEEISFSDLKRKALRLA
LYLKEFHNVKKGDVIAVLASKKIQQVIILLATLSLGAIYQPLFTAFGPEAIKMRTRDVKP
KVIFCQDDQKDKVNNAISFSKFDELLSYGELKEIEKINWDDAIILLYTSGTTGTPKGALI
AKRLLLNTYVYMKYGIGVRENDVFWNPADPGWAYGLYYGIIGPLMFGKTIIFLDEPFNPE
RTMEFMEENKVTNFAFAPTAYRMIAGMVKKKYDLVLERASSAGEPLNPEVIRWFMDKYNV
TIKDHYGQTEVGMVVYNGWGYDAKVKIGSMGLPAPGYEVDIIEDIIAVKRDSPGFHFLGY
LNNPEKTKESFRGDWYLTGDNAYKDEEGYLWFVGRKDDVVKVSGYRIGPFEVESVLLEFP
AVLESAVVADEDPIRGHVLHAYIVLKSGYTPSEELKKEIIDFVNTKYSRHVHLERVDFVD
KLPKTESGKIQRYLLRKK
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atggctagttatgaagaagttaggagaagtttttcgtggagtgaggtaattagatattta
gacaagaacccattagacgttttgacttctaatgacggtatagcagttaggagattcact
aagaacgctatggaggagataagcttctcagatcttaaaagaaaggcattaagacttgcc
ttatatctcaaggaatttcataatgttaaaaagggtgatgtaatagcagtattagcttca
aagaagattcaacaagtcataatacttttagcaactctctccctaggagcaatttatcaa
ccattatttactgcatttgggccagaggcaattaagatgaggactagagatgtaaaacca
aaagttatcttttgtcaagacgatcaaaaggataaggtaaataatgcaatatccttctcc
aagttcgatgaattattaagttacggtgaattgaaagagattgaaaagataaattgggat
gatgcgataattttactttacacttctggtactacgggaacacctaaaggggccctaatc
gctaagaggctacttcttaacacttatgtctacatgaaatatggtataggtgttagggaa
aatgacgtgttttggaaccccgcagatcctggatgggcttatgggctatattatggtata
ataggaccactaatgtttgggaaaactataatcttccttgacgaaccatttaacccagaa
aggacaatggagttcatggaggaaaataaggttactaattttgctttcgcacctacggca
tatagaatgatagctggaatggttaagaagaagtatgatttagtattggaaagagcgagt
tctgcaggtgaaccacttaacccagaagttataagatggtttatggataagtacaatgtt
actatcaaagatcattatggacaaactgaagttggaatggtagtttataacggctgggga
tatgacgcaaaagtaaaaatagggagtatgggattacctgcacctggttatgaagtcgat
ataatagaggatattatagctgtcaagagagattctccaggtttccacttcttgggatat
ctaaacaatccagagaagaccaaggaatcatttcgaggcgattggtacttgactggtgat
aatgcgtataaagatgaggaaggatatttatggtttgttggaaggaaggacgatgtggtt
aaggtatctggttacaggataggtccatttgaagttgagagcgtacttctagaatttccc
gcagtactagaatctgctgttgttgccgatgaagatccaatacgaggacatgtattgcat
gcttatattgtactcaaaagtggatacactccaagtgaggaactaaagaaggagattatt
gattttgtaaatactaaatattctaggcatgtacatctagaaagggttgactttgttgat
aaattgccaaagactgagagtggtaaaatacaaagatatctacttagaaagaaataa

DBGET integrated database retrieval system