KEGG   Sulfolobus islandicus M.16.4: M164_0835Help
Entry
M164_0835         CDS       T00906                                 

Definition
AMP-dependent synthetase and ligase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
sid  Sulfolobus islandicus M.16.4
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sid00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    M164_0835
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    M164_0835
   00620 Pyruvate metabolism
    M164_0835
   00640 Propanoate metabolism
    M164_0835
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    M164_0835
   00680 Methane metabolism
    M164_0835
Enzymes [BR:sid01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     M164_0835
Lipid biosynthesis proteins [BR:sid01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   M164_0835
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(776750..778297)
Genome map
AA seq 515 aa AA seqDB search
MKYEELVRNFSWSEVKNYFGKEFRDKLIRDSSDTAVFRVDSKWDKESLSYSQLKEKAQRL
SAFLRHEFKVRKGDVVACLASKKVEQVVYLVSSWILGAIYEPLFTAFGPAAIEMRTRDRK
PKVILAQDDQYDKIKDMFNNIITFPGKTGNSVSFDEAISYDRLRRDEWEKISYDDPSGLQ
YTSGTTGRPKGALQNFRTLYSLYVYIKYGIGLREDDVFWTPADPGWAYGLGVGIISPIIF
GKTVIFFDKLFSPEDTLKFIEDFKITNFAFVPTAYRMIMGTVKEPKKFNLRITRASSAGE
PLNPEVIRWFKENLGFMIKDHYGQTESGMVVYNGWSYEADVKPGSMGLLAPGYQVTIIDG
VIAVNKNCEGFYFLGYINDEERTKKVFKGDWYLTGDAAEIDKDGYFWFIGREDEVIKVSG
YRASPFEIESVLIQHPAIMEAAVIGVDDPVKGKIIKAYVVLKPNYKPSSDLANEIINFAR
EKYSRHAYPREVKFINSLPKTESGKIQKYKLKELG
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
atgaaatatgaagaattagtcagaaattttagttggagtgaggtaaaaaattactttggc
aaggagtttagggataagttaataagggatagtagcgatacagcagtattcagagtagat
agtaaatgggataaggaatccctatcatactctcaattaaaagaaaaagctcagaggcta
agtgcgtttttaagacatgaatttaaagtaaggaaaggtgacgtagtagcttgtctagca
tctaagaaagttgaacaagtagtttatttagtttctagctggatattaggagcaatatat
gagcctttattcacggctttcggacctgctgcaatagagatgaggactagagatagaaag
cctaaagttatactagcacaagatgatcagtacgataaaatcaaggacatgttcaataat
ataattacatttccaggaaagacaggaaattctgtatcctttgatgaagccatatcttat
gatagattgaggagagatgaatgggagaagatctcatacgacgatccctctggcttacaa
tacacttctggtactacggggaggcctaagggggcattacagaacttcagaacgctctat
agcctatacgtttacataaagtacggtattggtttaagagaagatgacgtattctggact
ccagcagacccaggttgggcttatggcctcggagtagggataatatctcctataatattc
gggaaaactgtaatatttttcgataagctattctctccagaagatactctgaaatttatt
gaagattttaaaattactaatttcgctttcgtgccaactgcttataggatgataatggga
actgtaaaagagcctaaaaaatttaacttaaggattactagagctagctctgcaggagaa
ccattaaatccagaagttataaggtggtttaaggaaaatttaggcttcatgatcaaggac
cattacggtcaaactgaatctggaatggtagtttataacggctggagctatgaggctgac
gttaaaccaggcagtatgggattacttgcaccaggatatcaagtcactataatcgatgga
gtaatagcagttaacaagaattgtgagggattctatttcttaggttatataaatgacgaa
gagagaactaagaaggtatttaaaggagattggtatttaactggtgatgctgcagaaata
gataaggatgggtacttctggttcatcgggagagaggatgaggtaataaaggtgtcagga
tatagggcgagtccatttgaaatagaaagtgttctaatacaacatcctgcaattatggaa
gcagcggtaataggtgtagatgacccagttaagggaaagataattaaagcttacgtagtt
ttaaagccgaattataagccctcaagtgatttggcgaatgagataattaacttcgcaagg
gaaaagtactcaagacatgcatatccaagggaagtgaaattcattaactcacttcctaag
actgagagcggtaaaatacaaaaatataagctgaaagaattaggatga

  All links  
No link information was found.   
DBGET integrated database retrieval system