KEGG   Sulfolobus islandicus M.16.4: M164_0861Help
Entry
M164_0861         CDS       T00906                                 

Definition
catalytic domain of components of variousde hydrogenase complexes
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
sid  Sulfolobus islandicus M.16.4
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Class
Metabolism; Overview; Carbon metabolism [PATH:sid01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:sid00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:sid00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:sid00620]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
807430..808614
Genome map
AA seq 394 aa AA seqDB search
MGKEVLMPKLGLTMTKGKIVQWKKKEGDRVQEGEDLVIIETEKITTAVKAAASGILLKIY
AKEGEEVPVGQIIAYIGEIGEKPPSLSTKPTLVSEQQQGQPTRIEEAKAISEVRASPRAR
RLAKEKGIDLVKIKGSGPGGMITEDDVIRELENIEKGVKFTATGLRVKEVIPMTAIRQEI
SRRMVQSLQTMAQVTLNIEINANSLVKIKNEVESKYSMKITYTDVLVKVVAKLIRSHPFL
NATLEGDQIKIIEDVNIGIAVALDQGLIVPVIRNADIKPITEIAKESHELADKARENKLN
PDEVTGGTFTISNLGMYDIDSFTPIINPPQTAILGVGRIRKAPVVIGDNISIGYVMWLSL
TFDHRVLDGHTAAKFLKELTEILEDENRLRAFLS
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgggcaaagaagtattaatgccaaagttaggtttaacaatgactaaagggaaaatagtt
caatggaagaaaaaagaaggagatagagttcaagaaggagaggacttagtaataatagaa
actgagaaaataacaactgcagtaaaagcagcagctagcggtatcttacttaagatttac
gccaaagaaggtgaagaggtacctgttggtcaaataatagcgtacataggtgaaattgga
gaaaaacccccatccttatctactaaacccactttggttagtgaacagcaacaagggcaa
ccaactcgaattgaagaggctaaggcaataagtgaagtaagagcttcacctagagctaga
aggcttgctaaagaaaaaggaatagatctagttaaaataaaggggagtggacctggaggt
atgataacagaagatgatgtaattagagagttagaaaatattgaaaaaggagtgaaattc
actgccactggtcttagagttaaagaagtgataccaatgactgcaataaggcaagaaata
agtagaagaatggttcagagccttcagacaatggcccaagtgacactaaatattgagatt
aatgcaaattcgttagttaaaataaaaaatgaagtagagtctaagtatagcatgaaaatt
acttatacagacgttctagttaaagtagtagctaaactcatcagaagtcatccatttcta
aacgcaacactagagggcgatcaaataaagataattgaggatgttaatataggaatagct
gtggctctagatcagggattaatagtaccagtaataaggaacgcagatattaagccaatt
actgaaatagcaaaagaaagtcatgaactagcggataaggctagagaaaacaagttaaat
cccgacgaagttacaggaggaacgtttacgataagtaatttaggaatgtatgatatagat
tcatttacaccaattataaatcctcctcaaactgctatattgggagtaggtaggataaga
aaggcaccagttgtaataggcgataatatctcaatcggttacgttatgtggctaagttta
acatttgatcatagagtgttagatggacataccgctgctaagttcttgaaagagcttact
gaaatattagaggatgagaatagattgagagcgtttttaagttag

DBGET integrated database retrieval system