KEGG   Sulfolobus islandicus M.16.4: M164_0861Help
Entry
M164_0861         CDS       T00906                                 

Definition
(GenBank) catalytic domain of components of variousde hydrogenase complexes
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
sid  Sulfolobus islandicus M.16.4
Pathway
sid00010  Glycolysis / Gluconeogenesis
sid00020  Citrate cycle (TCA cycle)
sid00620  Pyruvate metabolism
sid01100  Metabolic pathways
sid01110  Biosynthesis of secondary metabolites
sid01120  Microbial metabolism in diverse environments
sid01130  Biosynthesis of antibiotics
sid01200  Carbon metabolism
Module
sid_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sid00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    M164_0861
   00020 Citrate cycle (TCA cycle)
    M164_0861
   00620 Pyruvate metabolism
    M164_0861
Enzymes [BR:sid01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     M164_0861
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 CAT Peptidase_M23 Transferase PTS_EIIA_1
Motif
Other DBs
NCBI-ProteinID: ACR41474
JGI: SislK30861
UniProt: C4KFW0
Position
807430..808614
Genome map
AA seq 394 aa AA seqDB search
MGKEVLMPKLGLTMTKGKIVQWKKKEGDRVQEGEDLVIIETEKITTAVKAAASGILLKIY
AKEGEEVPVGQIIAYIGEIGEKPPSLSTKPTLVSEQQQGQPTRIEEAKAISEVRASPRAR
RLAKEKGIDLVKIKGSGPGGMITEDDVIRELENIEKGVKFTATGLRVKEVIPMTAIRQEI
SRRMVQSLQTMAQVTLNIEINANSLVKIKNEVESKYSMKITYTDVLVKVVAKLIRSHPFL
NATLEGDQIKIIEDVNIGIAVALDQGLIVPVIRNADIKPITEIAKESHELADKARENKLN
PDEVTGGTFTISNLGMYDIDSFTPIINPPQTAILGVGRIRKAPVVIGDNISIGYVMWLSL
TFDHRVLDGHTAAKFLKELTEILEDENRLRAFLS
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgggcaaagaagtattaatgccaaagttaggtttaacaatgactaaagggaaaatagtt
caatggaagaaaaaagaaggagatagagttcaagaaggagaggacttagtaataatagaa
actgagaaaataacaactgcagtaaaagcagcagctagcggtatcttacttaagatttac
gccaaagaaggtgaagaggtacctgttggtcaaataatagcgtacataggtgaaattgga
gaaaaacccccatccttatctactaaacccactttggttagtgaacagcaacaagggcaa
ccaactcgaattgaagaggctaaggcaataagtgaagtaagagcttcacctagagctaga
aggcttgctaaagaaaaaggaatagatctagttaaaataaaggggagtggacctggaggt
atgataacagaagatgatgtaattagagagttagaaaatattgaaaaaggagtgaaattc
actgccactggtcttagagttaaagaagtgataccaatgactgcaataaggcaagaaata
agtagaagaatggttcagagccttcagacaatggcccaagtgacactaaatattgagatt
aatgcaaattcgttagttaaaataaaaaatgaagtagagtctaagtatagcatgaaaatt
acttatacagacgttctagttaaagtagtagctaaactcatcagaagtcatccatttcta
aacgcaacactagagggcgatcaaataaagataattgaggatgttaatataggaatagct
gtggctctagatcagggattaatagtaccagtaataaggaacgcagatattaagccaatt
actgaaatagcaaaagaaagtcatgaactagcggataaggctagagaaaacaagttaaat
cccgacgaagttacaggaggaacgtttacgataagtaatttaggaatgtatgatatagat
tcatttacaccaattataaatcctcctcaaactgctatattgggagtaggtaggataaga
aaggcaccagttgtaataggcgataatatctcaatcggttacgttatgtggctaagttta
acatttgatcatagagtgttagatggacataccgctgctaagttcttgaaagagcttact
gaaatattagaggatgagaatagattgagagcgtttttaagttag

DBGET integrated database retrieval system