KEGG   Sulfolobus islandicus M.16.4: M164_0866Help
Entry
M164_0866         CDS       T00906                                 

Definition
alcohol dehydrogenase GroES
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
sid  Sulfolobus islandicus M.16.4
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:sid00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    M164_0866
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    M164_0866
  Lipid metabolism
   00071 Fatty acid degradation
    M164_0866
  Amino acid metabolism
   00350 Tyrosine metabolism
    M164_0866
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    M164_0866
   00626 Naphthalene degradation
    M164_0866
Enzymes [BR:sid01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     M164_0866
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(812853..813887)
Genome map
AA seq 344 aa AA seqDB search
MKAMKIVEFGKPLELSEVGEITKTKSNQVLIRVQAAGVCHTDVSVRSGVIYKRISANPPR
LPLTPGHEIAGIVEEVGDEVTGFTKGDKVLINPWQGEGNCFYCKIGEDQYCDSPTWLGIT
TDGGFQEYVLSNHNYVYKIRNLSPYEAAPLACAGVTSYRASKLARLNPSSYVAIIGAGGG
LGSIGVQIIRALYGSIIIAIDVNDEGLELASKFGADYTLNSRKEVYQEVLKITNGRGVDA
IIDFVGSENTIKSYYTFLAKLGRYIKVGTFGGGLPNEAGLKIHSMGWQFIGTLTGNRKEF
LEVISLAENGRIKPVVTKLRLEEANEALNNLERNKVTGRQVLIP
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcgatgaaaattgttgagtttggaaaaccattagaactatcagaggttggcgag
attactaagactaaatcaaatcaagtattaataagagtccaagcagctggagtatgccac
acagacgtttcagtgagaagtggggtaatttacaagaggattagtgcaaatccacctaga
cttccgcttacacccgggcatgaaatagctggaattgtagaggaagttggagatgaagtt
accggattcactaagggtgacaaagttctcataaatccctggcaaggtgagggaaattgc
ttctactgcaaaataggagaagaccagtactgcgactcgcctacgtggttgggtattacg
actgatgggggttttcaagaatacgtactatccaaccacaattatgtatataagataaga
aatctctcaccttatgaggcagcaccattagcttgtgctggggttacatcatatagggca
agtaaattagctaggttaaatccatccagctacgtagctataattggagccggaggaggg
ttaggaagtattggagtgcaaataatcagagcactttatggttccataattatagctata
gacgtcaacgatgagggactagaactcgcctcaaagttcggagctgactacactttaaac
agtagaaaagaagtatatcaagaagtacttaaaataacgaatggaaggggtgtagatgcc
ataatagatttcgtaggctcagaaaacacgatcaaaagttactatacctttttagctaaa
ttaggaaggtacatcaaagtaggaacctttggcgggggtctacccaatgaggctggatta
aaaatacactcaatgggatggcaattcataggtacactaactggaaacagaaaggaattc
ttggaagtcataagccttgcggaaaacggtaggataaaaccagttgtcactaagttaagg
ttggaggaagcaaatgaggcattgaacaacttggaaagaaataaggtaactggaagacaa
gtattaataccttaa

DBGET integrated database retrieval system