KEGG   Sulfolobus islandicus M.16.4: M164_1578Help
Entry
M164_1578         CDS       T00906                                 

Definition
(GenBank) glyceraldehyde-3-phosphate dehydrogenase, typeII
  KO
K00150  glyceraldehyde-3-phosphate dehydrogenase (NAD(P)) [EC:1.2.1.59]
Organism
sid  Sulfolobus islandicus M.16.4
Pathway
sid00010  Glycolysis / Gluconeogenesis
sid01100  Metabolic pathways
sid01110  Biosynthesis of secondary metabolites
sid01120  Microbial metabolism in diverse environments
sid01130  Biosynthesis of antibiotics
sid01200  Carbon metabolism
sid01230  Biosynthesis of amino acids
Module
sid_M00002  Glycolysis, core module involving three-carbon compounds
sid_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sid00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    M164_1578
Enzymes [BR:sid01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.59  glyceraldehyde-3-phosphate dehydrogenase (NAD(P)+) (phosphorylating)
     M164_1578
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Gp_dh_C DapB_N Gp_dh_N NAD_binding_3 2-Hacid_dh_C Sacchrp_dh_NADP GFO_IDH_MocA
Motif
Other DBs
NCBI-ProteinID: ACR42179
JGI: SislK31578
UniProt: C4KHW5
Position
1459260..1460282
Genome map
AA seq 340 aa AA seqDB search
MISVAVNGYGTIGKRVADAILKQPDMRLVGVAKTSPNYEAFIAHRKGIKIYVPQQSIKKF
EESGIPVAGTIEDLVKASDIVVDTTPNGVGAQYKPIYQQFQRNAIFQGGEKAEVADISFS
ALCNYDEALGKKYIRVVSCNTTALLRTICTINKVTKVEKVRATIVRRAADQKEVKKGPIN
SLVPDPATVPSHHAKDVNSVIKNLDIVTMAVIAPTTLMHMHFINITLKDKVEKKDVLSVL
ENTPRIVLISSKYDAEATAELVEVARDLKRERNDIPEVMVFDDSVYVKDNEVMLMYAVHQ
ESIVVPENVDAIRASTRLMSAEDSIRITNESLGILKGYLI
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
gtgattagtgtagctgttaatggatatggtactataggtaagagagttgctgatgctatc
cttaaacaaccagatatgagactagtaggggttgcaaagacatctccaaattacgaagcg
tttatagcacatcgtaaggggataaagatttacgtcccacaacaatctattaagaaattc
gaagaatctggaataccagttgctggcacaatagaggacctagtaaaagcctctgatatt
gtagtagatactacgcccaatggtgttggtgcacaatataagccaatttaccaacaattc
caaagaaacgctatattccaaggtggagaaaaagcggaagttgctgatatttcgttctca
gccttatgcaattacgatgaggcccttggcaaaaagtacattagagtcgtgtcatgtaat
actacagcactactaagaacaatatgcacaataaataaggtcactaaagttgaaaaagtt
agggcaacaatagttagaagagctgcagatcaaaaggaagttaagaaaggtcctataaat
tcattagtaccagaccctgcaactgtaccaagtcatcatgcaaaagacgttaacagtgtc
attaaaaatttagatatagttacaatggcagtaatagctccaacaacgttaatgcatatg
cactttattaacataaccttaaaggataaggtagagaaaaaagatgtacttagcgttctg
gagaacactcctaggatagtcctaatctcctcaaagtatgatgcagaagctacagcagaa
ttagtagaagtagcaagagatctgaaaagggaaagaaatgatattccagaggtgatggtg
ttcgatgactctgtttatgttaaggataacgaggttatgttaatgtatgcagtgcatcaa
gaatcaatagtggtaccagaaaatgtggatgcaataagggcctccactagattaatgagt
gcagaagactcaataagaattacaaatgaaagtttaggaatattaaaggggtacctaata
tga

DBGET integrated database retrieval system