KEGG   Sulfolobus islandicus M.16.4: M164_1862Help
Entry
M164_1862         CDS       T00906                                 

Definition
(GenBank) protein of unknown function DUF100
  KO
K01622  fructose 1,6-bisphosphate aldolase/phosphatase [EC:4.1.2.13 3.1.3.11]
Organism
sid  Sulfolobus islandicus M.16.4
Pathway
sid00010  Glycolysis / Gluconeogenesis
sid00030  Pentose phosphate pathway
sid00051  Fructose and mannose metabolism
sid00680  Methane metabolism
sid01100  Metabolic pathways
sid01110  Biosynthesis of secondary metabolites
sid01120  Microbial metabolism in diverse environments
sid01130  Biosynthesis of antibiotics
sid01200  Carbon metabolism
sid01230  Biosynthesis of amino acids
Module
sid_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sid00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    M164_1862
   00030 Pentose phosphate pathway
    M164_1862
   00051 Fructose and mannose metabolism
    M164_1862
  Energy metabolism
   00680 Methane metabolism
    M164_1862
Enzymes [BR:sid01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     M164_1862
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     M164_1862
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase_3
Motif
Other DBs
NCBI-ProteinID: ACR42465
JGI: SislK31862
UniProt: C4KIQ1
Position
1707561..1708709
Genome map
AA seq 382 aa AA seqDB search
MKTTLSVIKADIGSLAGHHVVHPDTIAAANKILAEAKRNNVISDYYITYVGDDLQLIMTH
NRGELDTKVHETAWNAFKEAAKVAKDLGLYAAGQDLLSDSFSGNLRGMGPGIAEMEFEER
PAEPVVIFMADKTEPGAYNLPLYKIFADPFNTAGLVIDPTMHEGYKFEVLDVYEGESIIL
NTPEETYDLLALIGTPSRYIVRRVYRKADNLQASVVSVERLNLIAGKYVGKDDPVMVVRA
QHGLPALGEILEAFTVPYLVPGWMRGSHYGPLMPVSQKDARATRFDGPPRLVGLGFNIKN
GKLVGPTDLFDDPAFDEVRRTAVIIADYIRKHGPFMPHRLEPQEMEYTTLPLVIEKLKNR
FKKETDMYKTKPSVYSHESSHE
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgaaaactacacttagtgtgatcaaagccgatataggaagcctagctggacatcatgtt
gttcatcctgatactatagctgcagctaataagatattagcagaagctaaaaggaataac
gtaatttccgattattacataacttatgttggagacgatttacaattaataatgactcat
aatagaggagaactagatactaaagttcatgaaacagcctggaatgcctttaaagaagct
gcgaaagtagctaaggatttaggattatatgctgcagggcaagatttgctttcagattcc
ttttctggaaatcttagaggaatgggtcctggaattgctgaaatggaatttgaggagaga
cctgctgaaccagtggttatttttatggctgataagactgagcctggtgcatataatcta
ccattatataaaatatttgcagacccattcaatactgctgggctagtaatagatccaaca
atgcatgaaggatataaatttgaagttttagatgtatatgaaggagagtcaataatttta
aacacaccagaagagacttacgatctacttgcgttaataggaacccctagcagatacatt
gttagaagagtttatagaaaggccgataatttacaagcctcagttgtttctgtagaaaga
ttgaatctaatagctggcaaatacgtaggcaaagacgatccagttatggtagtaagagct
caacacggtttgcctgcgttaggagaaatcttagaagcatttacagtaccttatttggta
ccggggtggatgagaggtagtcactatggacctcttatgccagtatcacaaaaggatgcg
agagccacaaggttcgatggtcctcctaggttagtaggtttaggatttaacatcaaaaat
gggaaactagtagggcctactgatttatttgatgatcctgcatttgatgaggtaaggaga
acagctgtaataattgcagattacattaggaaacatggcccatttatgcctcatagatta
gagccacaagaaatggagtacaccacactcccattagtaatagagaagttgaagaataga
tttaagaaagagacagatatgtataaaactaaaccaagcgtatattcacacgaaagttcg
catgaataa

DBGET integrated database retrieval system