KEGG   Sulfolobus islandicus M.16.4: M164_1862Help
Entry
M164_1862         CDS       T00906                                 

Definition
hypothetical protein
Orthology
K01622  
fructose 1,6-bisphosphate aldolase/phosphatase [EC:4.1.2.13 3.1.3.11]
Organism
sid  Sulfolobus islandicus M.16.4
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sid00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    M164_1862
   01230 Biosynthesis of amino acids
    M164_1862
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    M164_1862
   00030 Pentose phosphate pathway
    M164_1862
   00051 Fructose and mannose metabolism
    M164_1862
  Energy metabolism
   00680 Methane metabolism
    M164_1862
Enzymes [BR:sid01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     M164_1862
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     M164_1862
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1707561..1708709
Genome map
AA seq 382 aa AA seqDB search
MKTTLSVIKADIGSLAGHHVVHPDTIAAANKILAEAKRNNVISDYYITYVGDDLQLIMTH
NRGELDTKVHETAWNAFKEAAKVAKDLGLYAAGQDLLSDSFSGNLRGMGPGIAEMEFEER
PAEPVVIFMADKTEPGAYNLPLYKIFADPFNTAGLVIDPTMHEGYKFEVLDVYEGESIIL
NTPEETYDLLALIGTPSRYIVRRVYRKADNLQASVVSVERLNLIAGKYVGKDDPVMVVRA
QHGLPALGEILEAFTVPYLVPGWMRGSHYGPLMPVSQKDARATRFDGPPRLVGLGFNIKN
GKLVGPTDLFDDPAFDEVRRTAVIIADYIRKHGPFMPHRLEPQEMEYTTLPLVIEKLKNR
FKKETDMYKTKPSVYSHESSHE
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgaaaactacacttagtgtgatcaaagccgatataggaagcctagctggacatcatgtt
gttcatcctgatactatagctgcagctaataagatattagcagaagctaaaaggaataac
gtaatttccgattattacataacttatgttggagacgatttacaattaataatgactcat
aatagaggagaactagatactaaagttcatgaaacagcctggaatgcctttaaagaagct
gcgaaagtagctaaggatttaggattatatgctgcagggcaagatttgctttcagattcc
ttttctggaaatcttagaggaatgggtcctggaattgctgaaatggaatttgaggagaga
cctgctgaaccagtggttatttttatggctgataagactgagcctggtgcatataatcta
ccattatataaaatatttgcagacccattcaatactgctgggctagtaatagatccaaca
atgcatgaaggatataaatttgaagttttagatgtatatgaaggagagtcaataatttta
aacacaccagaagagacttacgatctacttgcgttaataggaacccctagcagatacatt
gttagaagagtttatagaaaggccgataatttacaagcctcagttgtttctgtagaaaga
ttgaatctaatagctggcaaatacgtaggcaaagacgatccagttatggtagtaagagct
caacacggtttgcctgcgttaggagaaatcttagaagcatttacagtaccttatttggta
ccggggtggatgagaggtagtcactatggacctcttatgccagtatcacaaaaggatgcg
agagccacaaggttcgatggtcctcctaggttagtaggtttaggatttaacatcaaaaat
gggaaactagtagggcctactgatttatttgatgatcctgcatttgatgaggtaaggaga
acagctgtaataattgcagattacattaggaaacatggcccatttatgcctcatagatta
gagccacaagaaatggagtacaccacactcccattagtaatagagaagttgaagaataga
tttaagaaagagacagatatgtataaaactaaaccaagcgtatattcacacgaaagttcg
catgaataa

DBGET integrated database retrieval system