KEGG   Sulfolobus islandicus M.16.4: M164_2404Help
Entry
M164_2404         CDS       T00906                                 

Definition
deoxycytidine triphosphate deaminase (dcD-2)
Orthology
K01494  
dCTP deaminase [EC:3.5.4.13]
Organism
sid  Sulfolobus islandicus M.16.4
Pathway
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:sid00240]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2228727..2229206
Genome map
AA seq 159 aa AA seqDB search
MILSHQSIKKLLGKVIMNYVEENVRENGYDLRICGEKYYEVEEGAKLPSIKAKIREISFK
EVANLSPLNTYLFESCEEFNMPDNLAVLITLKSTMARNGFLAPPTVIDAGYKGKIYLAIT
SVYGSSLAKEISTHHLIFLELDQKTERVYSGKYQGGIPI
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgatactctctcaccagtcaattaaaaagctgttaggcaaagtgataatgaattacgtt
gaggagaacgtaagggagaacggttacgatttaagaatatgtggtgaaaaatactacgaa
gttgaagagggggctaaattaccaagtataaaggctaaaattagggaaatatcttttaaa
gaggttgctaatctatcaccccttaatacttacttattcgagtcatgcgaggagtttaac
atgccagataacttggcggtattgataaccttaaaaagcactatggctaggaacggtttt
ctagctcctcctactgttattgatgctgggtacaagggaaagatttacttagctataact
tccgtctatggttcttcattagctaaggaaatcagcactcatcatttaatatttttagaa
ttggatcagaaaactgaaagagtttatagtggcaaatatcaaggaggtataccaatttag

DBGET integrated database retrieval system