KEGG   Sulfolobus islandicus M.16.4: M164_2404Help
Entry
M164_2404         CDS       T00906                                 

Definition
(GenBank) deoxycytidine triphosphate deaminase (dcD-2)
  KO
K01494  dCTP deaminase [EC:3.5.4.13]
Organism
sid  Sulfolobus islandicus M.16.4
Pathway
sid00240  Pyrimidine metabolism
sid01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sid00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    M164_2404
Enzymes [BR:sid01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.13  dCTP deaminase
     M164_2404
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: dUTPase DCD
Motif
Other DBs
NCBI-ProteinID: ACR43003
JGI: SislK32404
UniProt: C4KLC2
Position
2228727..2229206
Genome map
AA seq 159 aa AA seqDB search
MILSHQSIKKLLGKVIMNYVEENVRENGYDLRICGEKYYEVEEGAKLPSIKAKIREISFK
EVANLSPLNTYLFESCEEFNMPDNLAVLITLKSTMARNGFLAPPTVIDAGYKGKIYLAIT
SVYGSSLAKEISTHHLIFLELDQKTERVYSGKYQGGIPI
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgatactctctcaccagtcaattaaaaagctgttaggcaaagtgataatgaattacgtt
gaggagaacgtaagggagaacggttacgatttaagaatatgtggtgaaaaatactacgaa
gttgaagagggggctaaattaccaagtataaaggctaaaattagggaaatatcttttaaa
gaggttgctaatctatcaccccttaatacttacttattcgagtcatgcgaggagtttaac
atgccagataacttggcggtattgataaccttaaaaagcactatggctaggaacggtttt
ctagctcctcctactgttattgatgctgggtacaagggaaagatttacttagctataact
tccgtctatggttcttcattagctaaggaaatcagcactcatcatttaatatttttagaa
ttggatcagaaaactgaaagagtttatagtggcaaatatcaaggaggtataccaatttag

DBGET integrated database retrieval system