KEGG   Sulfolobus islandicus M.16.4: M164_2552Help
Entry
M164_2552         CDS       T00906                                 

Definition
(GenBank) pyruvate flavodoxin/ferredoxin oxidoreductase domain protein
  KO
K00169  pyruvate ferredoxin oxidoreductase alpha subunit [EC:1.2.7.1]
Organism
sid  Sulfolobus islandicus M.16.4
Pathway
sid00010  Glycolysis / Gluconeogenesis
sid00020  Citrate cycle (TCA cycle)
sid00620  Pyruvate metabolism
sid00640  Propanoate metabolism
sid00650  Butanoate metabolism
sid00680  Methane metabolism
sid00720  Carbon fixation pathways in prokaryotes
sid01100  Metabolic pathways
sid01120  Microbial metabolism in diverse environments
sid01130  Biosynthesis of antibiotics
sid01200  Carbon metabolism
Module
sid_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sid00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    M164_2552
   00020 Citrate cycle (TCA cycle)
    M164_2552
   00620 Pyruvate metabolism
    M164_2552
   00640 Propanoate metabolism
    M164_2552
   00650 Butanoate metabolism
    M164_2552
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    M164_2552
   00680 Methane metabolism
    M164_2552
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    M164_2552
Enzymes [BR:sid01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     M164_2552
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR_N PFOR_II Transketolase_C TPP_enzyme_N SHOCT
Motif
Other DBs
NCBI-ProteinID: ACR43144
JGI: SislK32552
UniProt: C4KEA6
Position
2367035..2368237
Genome map
AA seq 400 aa AA seqDB search
MIRKVISGNEAVALGVKLARVGVTGIYPITPQTTIIEKLAEMRAKGEIETEIVRVESEHS
AMAATFGAALGGVRAFTATASQGLLYMHEMIWWVAGSRVPVVMVVGTRAVGAPWNIWNEH
TDFTSERDSGWIMAFASNPQEALDLTLQAFRISEDERVFLPMMVGMDGFILSHTKTNVLI
PDQDQVDEFLPPRRQPYVIDPEDPIGMGNIFPPEGYMRLRESIDLALRNSENIIKEIGRE
YNKKINPLGDYSTLNVSYKLEDADYAIVLMGAWAGDAMEAVDTLREKGIKIGMLRIRYLR
PWSEKEIRNALKDKRAVLVLDRSTSFGRGGGPLYVEVKSTISDIVPQVKGVVSGLGGVTV
NKSELLYIFNKFVEGLKDDVIWYYPKEVGKIEFRTPRDIE
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgattagaaaggttatttctggaaatgaagctgttgcgttaggtgtgaaactagcgaga
gtaggagttacaggaatatacccaataacgccacaaactacgataattgagaaattagct
gagatgagagctaaaggtgaaattgaaaccgaaatagtgagagttgaaagtgagcactcg
gcaatggctgcaacgttcggtgctgctttaggtggtgttagggcttttactgctaccgca
tcgcaaggcttgctttacatgcatgaaatgatttggtgggtggctgggagtagagtacca
gtagtaatggttgtaggtactagagcagtaggagctccttggaacatttggaatgagcat
accgactttacaagtgagagggatagtggatggataatggcttttgcatccaatccgcaa
gaagcattagatctaactttacaagcgtttaggatttcagaggatgagagagtattctta
ccaatgatggtcggtatggatggattcatcctttcgcatactaagactaatgtactaata
cccgatcaagatcaagtagacgaattcttacctccaaggagacagccatatgtgatagat
ccagaggacccaataggtatggggaacatattccctccagagggctatatgagactaagg
gaatcaatagatttagcacttagaaattcagagaacataataaaagaaataggaagagaa
tataataagaaaattaatccattaggagattactccacactaaatgtgtcgtataaacta
gaagatgcggattacgcaatagttttaatgggagcttgggcaggagatgctatggaggct
gtagatacattaagagagaaggggataaaaataggcatgttaagaataaggtatcttaga
ccttggagtgagaaggagataagaaatgcgttgaaggataaaagggctgttctagtgtta
gatagaagtacgagttttggtaggggtggaggaccactttacgttgaagtaaagtccaca
atatcggacattgtaccacaggtaaaaggtgtagtgagtgggttgggaggtgttacagtt
aacaagagcgagttattgtatatatttaacaagtttgtagaaggcttaaaggatgacgta
atttggtattatccaaaggaggtggggaagattgagtttaggactccgagagatattgaa
taa

DBGET integrated database retrieval system