KEGG   Sulfolobus islandicus M.16.4: M164_2697Help
Entry
M164_2697         CDS       T00906                                 

Definition
Protein-L-isoaspartate (D-aspartate)O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
sid  Sulfolobus islandicus M.16.4
Brite
Enzymes [BR:sid01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     M164_2697
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2507970..2508680)
Genome map
AA seq 236 aa AA seqDB search
MSAKEDLLRSIKNSKLANAFIKVNREDFLPQLLKKYAYDPNYIDKPFYVTPNITTTALSL
GIYILDILNLEENQKVLEIGTGIGYYTALIAEVVGENNVVSIEIDDTMFEYAKNVLLIRY
PLIKLIKMDGSLGYEREAPYDRIVIWAAAPTIPCKLYEQLKENGIMVVPIGSEKAQGLYR
ITRIGYEPKIERIGDVIFMKMRGLFGFYEDDDPNERRIKKIEEKVNRLLSKFMNQS
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgagtgcaaaagaagacttattaagatctataaaaaattcaaagttggctaatgcattt
atcaaggttaatagagaagactttttgccgcaactattgaaaaaatacgcatatgaccca
aattatatagataaacccttttacgtgacacctaacattaccacaacggcgctaagttta
ggcatatatattcttgatattcttaatttagaagaaaatcagaaggttttagagataggt
actggtataggttattacacagcactgatagctgaagtagttggtgagaataacgttgta
tctatcgaaatcgatgatacgatgtttgagtacgctaaaaatgttcttctgatcagatac
cccctaattaaattaattaagatggatggaagtttaggatatgagagagaggctccttat
gatcgaatcgtaatatgggctgctgcgccgactataccttgtaagttatacgagcaactt
aaggaaaacggaatcatggtagtaccaataggtagtgaaaaagcccaaggtctttatagg
attactagaattggctacgagcctaagatagaaagaattggggatgtaatatttatgaaa
atgagaggcttatttggattttacgaggatgacgatccaaatgagaggagaataaagaaa
atagaagaaaaggtaaataggttgctgtccaaattcatgaatcaaagctag

DBGET integrated database retrieval system