KEGG   Sulfolobus islandicus M.16.4: M164_2703Help
Entry
M164_2703         CDS       T00906                                 

Definition
(GenBank) Triose-phosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
sid  Sulfolobus islandicus M.16.4
Pathway
sid00010  Glycolysis / Gluconeogenesis
sid00051  Fructose and mannose metabolism
sid00562  Inositol phosphate metabolism
sid01100  Metabolic pathways
sid01110  Biosynthesis of secondary metabolites
sid01120  Microbial metabolism in diverse environments
sid01130  Biosynthesis of antibiotics
sid01200  Carbon metabolism
sid01230  Biosynthesis of amino acids
Module
sid_M00002  Glycolysis, core module involving three-carbon compounds
sid_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sid00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    M164_2703
   00051 Fructose and mannose metabolism
    M164_2703
   00562 Inositol phosphate metabolism
    M164_2703
Enzymes [BR:sid01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     M164_2703
Exosome [BR:sid04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   M164_2703
  Exosomal proteins of bladder cancer cells
   M164_2703
  Exosomal proteins of melanoma cells
   M164_2703
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM ThiG NMO FMN_dh His_biosynth DUF561 IGPS G3P_antiterm DHO_dh Glu_synthase IMPDH Trp_syntA
Motif
Other DBs
NCBI-ProteinID: ACR43295
JGI: SislK32703
UniProt: C4KF32
Position
complement(2512645..2513328)
Genome map
AA seq 227 aa AA seqDB search
MKPPIIVINFKAYENSFGNKAIELGKKIEKISKEYSVEIILSVPATMIYRMVQEVDLPIY
AEHVDPVPLGAYTGAVLPEMIKDADAKGTLINHSERRLRADEIDDVLKRTRKLGLSSILC
VDRYELVYPFSLLRPDAILIEPPELIGTGISVSKAKPEVITKAVDEIRKSEGIYLIAGAG
ITTGEDVYKALKLGAHGIGVASAVMKAKEPEKVVEDFITSALKAISS
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaccccctattattgtaataaactttaaggcctacgaaaactcctttggtaataag
gcaattgagttaggtaaaaagatagaaaaaataagtaaggagtattcagttgaaataata
ttgtcagtaccagctactatgatctacagaatggtccaagaggtagatttaccaatttat
gctgaacatgtagatccagttcctttaggcgcttatacgggagccgtattaccagaaatg
ataaaagatgcagatgctaaagggacattgataaatcacagtgagagacgtctaagggct
gatgaaatagatgacgtattaaaaagaactaggaaattaggtttgagtagtatactatgc
gttgacagatatgagttagtctatccctttagtttactaaggcctgatgcaattttgata
gagcctccagaattgataggaaccggtatctcagtatctaaagccaaacctgaggtaata
acaaaagccgtggatgagataagaaagtctgaggggatctatttaatagcgggtgctgga
attacaaccggtgaggacgtttataaagcgttaaagctaggagctcatggaataggtgta
gcaagtgcagtcatgaaggctaaagaacctgagaaagttgttgaagattttatcacaagt
gcattgaaggctatctcttcttag

DBGET integrated database retrieval system