KEGG   Sulfolobus islandicus M.16.4: M164_2843Help
Entry
M164_2843         CDS       T00906                                 

Definition
(GenBank) pyruvate ferredoxin, flavodoxin oxidoreductase, delta subunit
  KO
K00171  pyruvate ferredoxin oxidoreductase delta subunit [EC:1.2.7.1]
Organism
sid  Sulfolobus islandicus M.16.4
Pathway
sid00010  Glycolysis / Gluconeogenesis
sid00020  Citrate cycle (TCA cycle)
sid00620  Pyruvate metabolism
sid00640  Propanoate metabolism
sid00650  Butanoate metabolism
sid00680  Methane metabolism
sid00720  Carbon fixation pathways in prokaryotes
sid01100  Metabolic pathways
sid01120  Microbial metabolism in diverse environments
sid01130  Biosynthesis of antibiotics
sid01200  Carbon metabolism
Module
sid_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sid00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    M164_2843
   00020 Citrate cycle (TCA cycle)
    M164_2843
   00620 Pyruvate metabolism
    M164_2843
   00640 Propanoate metabolism
    M164_2843
   00650 Butanoate metabolism
    M164_2843
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    M164_2843
   00680 Methane metabolism
    M164_2843
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    M164_2843
Enzymes [BR:sid01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     M164_2843
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4_21 Fer4 Fer4_7 Fer4_16 Fer4_2 Fer4_8 Fer4_17 Fer4_10 Fer4_9 Fer4_13 Fer4_4 Fer4_22 Fer4_6
Motif
Other DBs
NCBI-ProteinID: ACR40996
UniProt: C4KL31
Position
complement(312746..313837)
Genome map
AA seq 363 aa AA seqDB search
MGVKDEVKYVEIVYRGIFQKRLAKYIAEGIVYTAREMGRPALSFGRYGDSPERNGVPAKY
YVGIGNGVNEEDLIGYSTRVEPDLVDTIIVLDDTLLKGVESWAWQGVQPINLKLKSNGTM
LVTSTKRINELLKMIPKKDFNWTLGVINTEPSFSGLWAFKDDLTMEKVWGGLAKLRPDII
DLDHLIKYVSKKQDANKRISAVKEAYSSVDYRTVMKGEGIDFVYNPPRLLTWQEMLEGTV
IPAVPRGKRNELFKRGTTKFERPTVDFDTCIKCKLCWIYCPDECFDETPDGYYDIAYDYC
VGCGICADVCPVKDCIVMVDESMFTDYRRPYEMWKENKAKYKEWLKNVRQARKERVYVPG
LGR
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgggagtaaaagatgaagtgaagtatgtagagatagtatataggggtatattccagaaa
agattggcaaaatatattgcagaaggaatcgtgtatactgcaagggaaatggggagacca
gccctatctttcggaagatatggagattctccagaaaggaacggagtaccggcgaaatac
tatgttggaataggaaatggagtgaatgaggaagaccttatagggtactcaacaagagta
gagcctgatctagtagataccattattgtactagacgataccctattaaagggtgtagaa
tcgtgggcatggcaaggggtacaaccaatcaaccttaaactaaagagtaacgggacaatg
ctagtaacctctacaaagagaattaacgaattgttgaaaatgatacctaaaaaggacttc
aattggactctaggagtaataaatactgaaccatcattttcgggactatgggcatttaag
gatgatttaacaatggagaaagtctggggaggattagcaaagttaagaccagatataatt
gatttagatcatttaattaaatatgtaagtaaaaaacaagatgctaacaagagaatatct
gcggtcaaggaagcatattcgtcagtagattacagaactgtaatgaaaggtgagggaata
gatttcgtatataatccgcctagactactaacatggcaggagatgttggaaggtacagta
attcccgcagttcctagaggaaagagaaacgaactctttaagagagggactacgaaattt
gagagacctacagtagatttcgacacttgtatcaaatgtaagttatgttggatatactgt
ccggatgaatgttttgatgagacgccagatggatattacgatatagcatatgattactgt
gtaggctgtggcatatgcgctgatgtatgtcccgttaaggattgcatagtaatggtagat
gaatcgatgttcacagattacagaagaccatatgagatgtggaaggagaataaggcaaag
tacaaggaatggttaaagaatgtaaggcaagctaggaaagaaagggtctacgttccgggg
ttagggagatga

DBGET integrated database retrieval system