KEGG   Streptococcus intermedius JTH08: SCIM_0045Help
Entry
SCIM_0045         CDS       T02156                                 

Definition
beta-galactosidase
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
sie  Streptococcus intermedius JTH08
Pathway
Galactose metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:sie00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
61955..63760
Genome map
AA seq 601 aa AA seqDB search
MKEGNGLERFEIREEFYLNQQPFKILSGAIHYFRIQPDDWYHSLYNLKALGFNTVETYIP
WNAHEPMKGQFDFEGILDVEKFLQTAQDLGLYVLLRSSPYICAEWEFGGLPAWLLEENMR
IRSSDPAYLAAVANYYDELLPRLVSHLLENGGSILMMQVENEYGSYGEDKEYLRAVRDMM
QERGVTCPLFTSDGPWRATLRAGTLIEDDMFVTGNFGSKAKENFAQMQEFFDEHDKKWPL
MCMEFWDGWFNRWKEPTVTRDPEELAEAVHEVLQQGSINLYMFHGGTNFGFMNGCSARGS
IDLPQVTSYDYEALLDEQGNPTPKYFAVQRMLKKYYPEYPQREPLVKETFELKNIPLNER
VSLFETLEDIAQPIESLYPMKMEELGQNVGYLLYRTQAEWDADKERVRVIDGRDRMQLFV
DGNFITTQYQTEIGEDIFISQQKRSIHRLDILMENMGRVNYGHKLLAESQHKGIRTGVCK
DLHFMLHWNQYPLEFENPEAIDFTKEWHEDQPAFYAFAVELKALKDTYLDLTHFGKGVVF
VNGVNIGRFWDVGPTLSLYIPHGLLRIGNNRIIIFETEGKYSKFIDLVHKPTFKPIKGDK
L
NT seq 1806 nt NT seq  +upstreamnt  +downstreamnt
gtgaaagagggaaatggtttggaaagatttgagattagagaagaattttatctgaatcaa
cagccttttaaaatattatctggtgctattcattattttcggattcagccagatgattgg
tatcattcgctttataatctgaaagctttaggctttaatacagtagaaacgtatatccct
tggaatgcgcatgagccaatgaaagggcaattcgattttgaaggtatccttgatgtagaa
aaattcttgcaaacagcacaagatttgggattgtatgttcttcttcggagttctccctat
atctgtgcagaatgggaatttggcggtttacccgcttggctcttagaagaaaacatgaga
attcggtcttctgatcctgcttatcttgctgcagttgccaactattatgatgaattgctt
ccacgattagtgtcacatcttttggaaaatggtggcagtattctcatgatgcaagtagaa
aatgaatatggctcttatggcgaagacaaggaatacttgagagctgttcgagacatgatg
caagagcgaggtgtgacttgtccgctctttacgtcagatggaccctggcgagctactttg
cgagcaggaacgctcattgaggatgatatgtttgtaacggggaattttggctctaaggca
aaagaaaattttgcgcagatgcaggaattctttgatgagcatgacaaaaagtggccactc
atgtgtatggaattttgggacggttggttcaatcgttggaaagagccaactgtcacgcga
gatccagaagaattagctgaagcggttcacgaagtcttacaacaaggcagtatcaacctt
tatatgtttcatggaggaacaaattttgggttcatgaatggttgttcagcgcgaggaagc
attgacctgccacaagtaacgtcttatgattacgaagctctccttgatgaacaaggaaat
ccaacaccaaaatactttgccgttcagcgaatgttaaaaaaatattatccagagtatcca
cagagagagcctttggtaaaagaaacgtttgagttaaagaatattccactcaatgagaga
gttagcttatttgagactttagaagatatagcgcagccaattgagagtctgtatcctatg
aaaatggaggagttgggccaaaatgttggttatctgctctatcgtacacaagcagaatgg
gatgcggataaggaacgagttcgtgtcattgacggacgtgatcggatgcagctttttgta
gacgggaacttcatcaccactcagtatcagacagaaattggtgaagatatctttatttca
caacagaaacggtcgatacacaggctggatattttgatggagaatatggggcgtgttaac
tatgggcataaacttctggcagagagccagcataaaggtattcgcacaggagtttgcaaa
gacctccattttatgcttcattggaatcagtatccattagagttcgaaaatccagaagcg
attgattttacgaaagaatggcatgaagatcagccagcattctatgcatttgccgttgaa
ttgaaagcgcttaaagatacgtatttagatttaacccattttggtaagggagttgtcttt
gtcaacggcgtcaatattggtcgtttctgggatgttggcccaaccttatcactttacatt
ccacatggtctcttacgaatcggaaacaatcgcattattatttttgaaaccgaaggaaaa
tatagtaaattcattgatttagttcataaacctacatttaaaccaataaagggggacaaa
ttatga

DBGET integrated database retrieval system