KEGG   Streptococcus intermedius JTH08: SCIM_0045Help
Entry
SCIM_0045         CDS       T02156                                 

Definition
beta-galactosidase
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
sie  Streptococcus intermedius JTH08
Pathway
Galactose metabolism
Brite
KEGG Orthology (KO) [BR:sie00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    SCIM_0045
Enzymes [BR:sie01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     SCIM_0045
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
61955..63760
Genome map
AA seq 601 aa AA seqDB search
MKEGNGLERFEIREEFYLNQQPFKILSGAIHYFRIQPDDWYHSLYNLKALGFNTVETYIP
WNAHEPMKGQFDFEGILDVEKFLQTAQDLGLYVLLRSSPYICAEWEFGGLPAWLLEENMR
IRSSDPAYLAAVANYYDELLPRLVSHLLENGGSILMMQVENEYGSYGEDKEYLRAVRDMM
QERGVTCPLFTSDGPWRATLRAGTLIEDDMFVTGNFGSKAKENFAQMQEFFDEHDKKWPL
MCMEFWDGWFNRWKEPTVTRDPEELAEAVHEVLQQGSINLYMFHGGTNFGFMNGCSARGS
IDLPQVTSYDYEALLDEQGNPTPKYFAVQRMLKKYYPEYPQREPLVKETFELKNIPLNER
VSLFETLEDIAQPIESLYPMKMEELGQNVGYLLYRTQAEWDADKERVRVIDGRDRMQLFV
DGNFITTQYQTEIGEDIFISQQKRSIHRLDILMENMGRVNYGHKLLAESQHKGIRTGVCK
DLHFMLHWNQYPLEFENPEAIDFTKEWHEDQPAFYAFAVELKALKDTYLDLTHFGKGVVF
VNGVNIGRFWDVGPTLSLYIPHGLLRIGNNRIIIFETEGKYSKFIDLVHKPTFKPIKGDK
L
NT seq 1806 nt NT seq  +upstreamnt  +downstreamnt
gtgaaagagggaaatggtttggaaagatttgagattagagaagaattttatctgaatcaa
cagccttttaaaatattatctggtgctattcattattttcggattcagccagatgattgg
tatcattcgctttataatctgaaagctttaggctttaatacagtagaaacgtatatccct
tggaatgcgcatgagccaatgaaagggcaattcgattttgaaggtatccttgatgtagaa
aaattcttgcaaacagcacaagatttgggattgtatgttcttcttcggagttctccctat
atctgtgcagaatgggaatttggcggtttacccgcttggctcttagaagaaaacatgaga
attcggtcttctgatcctgcttatcttgctgcagttgccaactattatgatgaattgctt
ccacgattagtgtcacatcttttggaaaatggtggcagtattctcatgatgcaagtagaa
aatgaatatggctcttatggcgaagacaaggaatacttgagagctgttcgagacatgatg
caagagcgaggtgtgacttgtccgctctttacgtcagatggaccctggcgagctactttg
cgagcaggaacgctcattgaggatgatatgtttgtaacggggaattttggctctaaggca
aaagaaaattttgcgcagatgcaggaattctttgatgagcatgacaaaaagtggccactc
atgtgtatggaattttgggacggttggttcaatcgttggaaagagccaactgtcacgcga
gatccagaagaattagctgaagcggttcacgaagtcttacaacaaggcagtatcaacctt
tatatgtttcatggaggaacaaattttgggttcatgaatggttgttcagcgcgaggaagc
attgacctgccacaagtaacgtcttatgattacgaagctctccttgatgaacaaggaaat
ccaacaccaaaatactttgccgttcagcgaatgttaaaaaaatattatccagagtatcca
cagagagagcctttggtaaaagaaacgtttgagttaaagaatattccactcaatgagaga
gttagcttatttgagactttagaagatatagcgcagccaattgagagtctgtatcctatg
aaaatggaggagttgggccaaaatgttggttatctgctctatcgtacacaagcagaatgg
gatgcggataaggaacgagttcgtgtcattgacggacgtgatcggatgcagctttttgta
gacgggaacttcatcaccactcagtatcagacagaaattggtgaagatatctttatttca
caacagaaacggtcgatacacaggctggatattttgatggagaatatggggcgtgttaac
tatgggcataaacttctggcagagagccagcataaaggtattcgcacaggagtttgcaaa
gacctccattttatgcttcattggaatcagtatccattagagttcgaaaatccagaagcg
attgattttacgaaagaatggcatgaagatcagccagcattctatgcatttgccgttgaa
ttgaaagcgcttaaagatacgtatttagatttaacccattttggtaagggagttgtcttt
gtcaacggcgtcaatattggtcgtttctgggatgttggcccaaccttatcactttacatt
ccacatggtctcttacgaatcggaaacaatcgcattattatttttgaaaccgaaggaaaa
tatagtaaattcattgatttagttcataaacctacatttaaaccaataaagggggacaaa
ttatga

DBGET integrated database retrieval system