KEGG   Streptococcus intermedius JTH08: SCIM_0062Help
Entry
SCIM_0062         CDS       T02156                                 

Gene name
adhE
Definition
alcohol-acetaldehyde dehydrogenase
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
sie  Streptococcus intermedius JTH08
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:sie00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    SCIM_0062 (adhE)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SCIM_0062 (adhE)
   00620 Pyruvate metabolism
    SCIM_0062 (adhE)
   00650 Butanoate metabolism
    SCIM_0062 (adhE)
  Lipid metabolism
   00071 Fatty acid degradation
    SCIM_0062 (adhE)
  Amino acid metabolism
   00350 Tyrosine metabolism
    SCIM_0062 (adhE)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SCIM_0062 (adhE)
   00626 Naphthalene degradation
    SCIM_0062 (adhE)
Enzymes [BR:sie01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     SCIM_0062 (adhE)
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     SCIM_0062 (adhE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
81146..83809
Genome map
AA seq 887 aa AA seqDB search
MEEDMADKKTVAKEDKVLAAQKHVDELVQKGLVALEEMRKLDQEQVDYIVAKASVAALDA
HGQLALHALEETGRGVFEDKATKNLFACEHVVNNMRHTKTVGIIDEDDVTGLTLIAEPVG
VVCGITPTTNPTSTAIFKSLISLKTRNPIIFAFHPSAQESSAHAAQIVRDAAIAAGAPEN
CVQWITQPSMEATSALMNHEGIATILATGGNAMVKAAYSCGKPALGVGAGNVPAYVEKSA
NIRQAAHDIVMSKSFDNGMVCASEQAVIIDKEVYNEFLEEFKSYHTYFVNKKEKALLEDF
CFGVKANSKNCAGAKLNPDIVGKSAVWIAEQAGFSVPEDTNILAAECKEVGEKEPLTREK
LSPVIAVLKSESREDGINKARQMVEFHGLGHSAAIHTADEELTKEFGKAVKAIRVICNSP
STFGGIGDVYNAFLPSLTLGCGSYGRNSVGDNVSAVNLLNIKKVGRRNNNMQWFKVPSKT
YFERNSIQYLQKCRDVERVMIVTDHSMVELGFLDRIIEQLELRRNKVTYQIFAEVEPDPD
ISTVMKGTDLMRTFKPDTIIALGGGSPMDAAKVMWLFYEQPEVDFHDLVQKFMDIRKRAF
KFPQLGRKTKFIGIPTTSGTGSEVTPFAVISDKANNRKYPIADYSLTPTVAIVDPALVLT
VPGFIAADTGMDVLTHATEAYVSQMANDFTDGLALQAIKLVFEHLENSVKNADFHSREKM
HNASTMAGMAFANAFLGISHSMAHKIGAQFHTIHGRTNAILLPYVIRYNGTRPAKAATWP
KYNYYRADEKYQDIAKLLGLPASTPEEGVESYAKAVYELGERVGIKMNFRDQGIDEKEWK
EHSRELAFLAYEDQCSPANPRLPMVDHMQEIIEDAYYGYKERPGRRK
NT seq 2664 nt NT seq  +upstreamnt  +downstreamnt
ttggaggaagatatggctgataaaaaaactgtagcaaaagaagacaaagtcttagctgct
caaaaacacgtggatgaacttgttcaaaagggtcttgttgcgcttgaggaaatgcgtaaa
ttagatcaagaacaagttgattatatcgttgcgaaagcttctgttgctgcgcttgatgca
catggtcaactggctttacatgctctagaagaaactgggcgtggtgtttttgaagacaaa
gcaaccaaaaatctctttgcttgtgaacatgtggtaaacaatatgcgccataccaaaact
gttggaatcattgatgaagatgacgtaactggtttgacacttattgcagaaccggtcggc
gttgtctgtgggatcacaccgacaacaaacccaacttcaacagcaattttcaaatcatta
atttctttgaaaacgcgtaatcctattatctttgctttccacccatcagctcaagaatca
tctgctcatgcggcgcaaatcgtgcgtgatgcagcgattgcagcaggtgcgcctgaaaat
tgtgtacagtggattactcaaccatcaatggaagctacttcagcactgatgaaccacgaa
gggattgcaacaatccttgcaactggtggaaatgcgatggtgaaagctgcttactcatgt
gggaaaccggctcttggagttggtgccggaaatgtaccagcttatgtcgaaaaatcagct
aatatccgccaagcagctcatgatattgtgatgtctaaatcatttgataacggaatggtc
tgtgcttctgagcaagctgttatcattgataaagaagtctacaatgagtttcttgaagaa
tttaaatcttatcacacttactttgtcaataagaaagaaaaagctcttttggaagatttc
tgctttggtgtgaaagccaacagtaaaaattgcgcaggtgctaaattaaatccagatatt
gttggtaaatcagctgtttggattgcggagcaagcaggtttctctgtaccagaagataca
aatattttggctgcagaatgtaaggaagttggcgaaaaagaaccgttgacacgtgaaaaa
ttgtcaccagtcatcgctgttttgaaatcagaatctcgtgaagacggcattaacaaggct
cgtcaaatggttgaattccatggacttggtcactcagcggctattcatacagcagatgaa
gaattgacaaaagaatttggtaaagctgtaaaagcgattcgtgtaatttgcaattcacct
tctactttcggtggtatcggggacgtttacaatgcatttttaccttcattaacattagga
tgtggctcttatggacgcaactctgttggtgataatgtcagtgctgtaaatctcttgaat
atcaaaaaagtaggaagacgtaataataatatgcaatggtttaaagttccttcaaaaaca
tacttcgaacgcaattcaattcaatatctacaaaaatgtcgtgatgtagagcgtgtcatg
attgtcacagaccactcaatggttgaattaggattccttgaccgcattattgagcagtta
gaacttcgtcgcaataaagtaacctatcaaatctttgcagaggttgaaccagatccagat
atttcgaccgtaatgaagggaacagatttgatgcgtaccttcaaaccggatacaattatt
gctttgggtggtggttcaccaatggatgcggcaaaagttatgtggcttttctatgaacaa
ccagaagtagacttccatgaccttgttcaaaaattcatggatattcgtaaacgtgccttc
aagttccctcagcttggcagaaaaacgaaatttatcggtattccgacaacttcaggtaca
ggttcagaggttactccatttgctgttatctctgataaagctaataaccgtaaataccca
attgcagactattccttgacgccgacagttgctattgttgatcctgcgctggtattgact
gttccaggatttatcgcagctgatactggtatggacgtattgacacatgcgacagaagcc
tatgtttctcaaatggcaaatgactttacagacggtttggcattgcaagcgattaaatta
gtttttgaacatcttgaaaactctgtgaagaatgctgatttccactctcgtgaaaagatg
cacaatgcttcgactatggcgggtatggcgtttgccaatgctttccttggaatttctcac
tcaatggctcacaagattggtgcacaattccatacaattcatggtcggacaaatgccatc
ctgttgccgtatgttattcgctataatggtactcgccctgctaaagcagctacatggcct
aagtacaactactaccgtgctgatgaaaaataccaagatattgctaaattgctcggtctt
ccagcttctactccagaagaaggcgttgaatcatatgccaaagcggtttacgaacttggt
gagcgtgtaggaattaaaatgaacttccgtgatcaaggaattgatgagaaagaatggaaa
gaacattctcgtgagttagcattcttagcttatgaagatcagtgttcaccagcgaatcct
cgtcttccaatggttgaccatatgcaagaaatcattgaagatgcatattatggatacaaa
gaacgtccaggacgtcggaaataa

DBGET integrated database retrieval system