KEGG   Streptococcus intermedius JTH08: SCIM_0062Help
Entry
SCIM_0062         CDS       T02156                                 

Gene name
adhE
Definition
(RefSeq) alcohol-acetaldehyde dehydrogenase
  KO
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
sie  Streptococcus intermedius JTH08
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:sie00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    SCIM_0062 (adhE)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SCIM_0062 (adhE)
   00620 Pyruvate metabolism
    SCIM_0062 (adhE)
   00650 Butanoate metabolism
    SCIM_0062 (adhE)
  Lipid metabolism
   00071 Fatty acid degradation
    SCIM_0062 (adhE)
  Amino acid metabolism
   00350 Tyrosine metabolism
    SCIM_0062 (adhE)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SCIM_0062 (adhE)
   00626 Naphthalene degradation
    SCIM_0062 (adhE)
Enzymes [BR:sie01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     SCIM_0062 (adhE)
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     SCIM_0062 (adhE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
81146..83809
Genome map
AA seq 887 aa AA seqDB search
MEEDMADKKTVAKEDKVLAAQKHVDELVQKGLVALEEMRKLDQEQVDYIVAKASVAALDA
HGQLALHALEETGRGVFEDKATKNLFACEHVVNNMRHTKTVGIIDEDDVTGLTLIAEPVG
VVCGITPTTNPTSTAIFKSLISLKTRNPIIFAFHPSAQESSAHAAQIVRDAAIAAGAPEN
CVQWITQPSMEATSALMNHEGIATILATGGNAMVKAAYSCGKPALGVGAGNVPAYVEKSA
NIRQAAHDIVMSKSFDNGMVCASEQAVIIDKEVYNEFLEEFKSYHTYFVNKKEKALLEDF
CFGVKANSKNCAGAKLNPDIVGKSAVWIAEQAGFSVPEDTNILAAECKEVGEKEPLTREK
LSPVIAVLKSESREDGINKARQMVEFHGLGHSAAIHTADEELTKEFGKAVKAIRVICNSP
STFGGIGDVYNAFLPSLTLGCGSYGRNSVGDNVSAVNLLNIKKVGRRNNNMQWFKVPSKT
YFERNSIQYLQKCRDVERVMIVTDHSMVELGFLDRIIEQLELRRNKVTYQIFAEVEPDPD
ISTVMKGTDLMRTFKPDTIIALGGGSPMDAAKVMWLFYEQPEVDFHDLVQKFMDIRKRAF
KFPQLGRKTKFIGIPTTSGTGSEVTPFAVISDKANNRKYPIADYSLTPTVAIVDPALVLT
VPGFIAADTGMDVLTHATEAYVSQMANDFTDGLALQAIKLVFEHLENSVKNADFHSREKM
HNASTMAGMAFANAFLGISHSMAHKIGAQFHTIHGRTNAILLPYVIRYNGTRPAKAATWP
KYNYYRADEKYQDIAKLLGLPASTPEEGVESYAKAVYELGERVGIKMNFRDQGIDEKEWK
EHSRELAFLAYEDQCSPANPRLPMVDHMQEIIEDAYYGYKERPGRRK
NT seq 2664 nt NT seq  +upstreamnt  +downstreamnt
ttggaggaagatatggctgataaaaaaactgtagcaaaagaagacaaagtcttagctgct
caaaaacacgtggatgaacttgttcaaaagggtcttgttgcgcttgaggaaatgcgtaaa
ttagatcaagaacaagttgattatatcgttgcgaaagcttctgttgctgcgcttgatgca
catggtcaactggctttacatgctctagaagaaactgggcgtggtgtttttgaagacaaa
gcaaccaaaaatctctttgcttgtgaacatgtggtaaacaatatgcgccataccaaaact
gttggaatcattgatgaagatgacgtaactggtttgacacttattgcagaaccggtcggc
gttgtctgtgggatcacaccgacaacaaacccaacttcaacagcaattttcaaatcatta
atttctttgaaaacgcgtaatcctattatctttgctttccacccatcagctcaagaatca
tctgctcatgcggcgcaaatcgtgcgtgatgcagcgattgcagcaggtgcgcctgaaaat
tgtgtacagtggattactcaaccatcaatggaagctacttcagcactgatgaaccacgaa
gggattgcaacaatccttgcaactggtggaaatgcgatggtgaaagctgcttactcatgt
gggaaaccggctcttggagttggtgccggaaatgtaccagcttatgtcgaaaaatcagct
aatatccgccaagcagctcatgatattgtgatgtctaaatcatttgataacggaatggtc
tgtgcttctgagcaagctgttatcattgataaagaagtctacaatgagtttcttgaagaa
tttaaatcttatcacacttactttgtcaataagaaagaaaaagctcttttggaagatttc
tgctttggtgtgaaagccaacagtaaaaattgcgcaggtgctaaattaaatccagatatt
gttggtaaatcagctgtttggattgcggagcaagcaggtttctctgtaccagaagataca
aatattttggctgcagaatgtaaggaagttggcgaaaaagaaccgttgacacgtgaaaaa
ttgtcaccagtcatcgctgttttgaaatcagaatctcgtgaagacggcattaacaaggct
cgtcaaatggttgaattccatggacttggtcactcagcggctattcatacagcagatgaa
gaattgacaaaagaatttggtaaagctgtaaaagcgattcgtgtaatttgcaattcacct
tctactttcggtggtatcggggacgtttacaatgcatttttaccttcattaacattagga
tgtggctcttatggacgcaactctgttggtgataatgtcagtgctgtaaatctcttgaat
atcaaaaaagtaggaagacgtaataataatatgcaatggtttaaagttccttcaaaaaca
tacttcgaacgcaattcaattcaatatctacaaaaatgtcgtgatgtagagcgtgtcatg
attgtcacagaccactcaatggttgaattaggattccttgaccgcattattgagcagtta
gaacttcgtcgcaataaagtaacctatcaaatctttgcagaggttgaaccagatccagat
atttcgaccgtaatgaagggaacagatttgatgcgtaccttcaaaccggatacaattatt
gctttgggtggtggttcaccaatggatgcggcaaaagttatgtggcttttctatgaacaa
ccagaagtagacttccatgaccttgttcaaaaattcatggatattcgtaaacgtgccttc
aagttccctcagcttggcagaaaaacgaaatttatcggtattccgacaacttcaggtaca
ggttcagaggttactccatttgctgttatctctgataaagctaataaccgtaaataccca
attgcagactattccttgacgccgacagttgctattgttgatcctgcgctggtattgact
gttccaggatttatcgcagctgatactggtatggacgtattgacacatgcgacagaagcc
tatgtttctcaaatggcaaatgactttacagacggtttggcattgcaagcgattaaatta
gtttttgaacatcttgaaaactctgtgaagaatgctgatttccactctcgtgaaaagatg
cacaatgcttcgactatggcgggtatggcgtttgccaatgctttccttggaatttctcac
tcaatggctcacaagattggtgcacaattccatacaattcatggtcggacaaatgccatc
ctgttgccgtatgttattcgctataatggtactcgccctgctaaagcagctacatggcct
aagtacaactactaccgtgctgatgaaaaataccaagatattgctaaattgctcggtctt
ccagcttctactccagaagaaggcgttgaatcatatgccaaagcggtttacgaacttggt
gagcgtgtaggaattaaaatgaacttccgtgatcaaggaattgatgagaaagaatggaaa
gaacattctcgtgagttagcattcttagcttatgaagatcagtgttcaccagcgaatcct
cgtcttccaatggttgaccatatgcaagaaatcattgaagatgcatattatggatacaaa
gaacgtccaggacgtcggaaataa

DBGET integrated database retrieval system