KEGG   Streptococcus intermedius JTH08: SCIM_0085Help
Entry
SCIM_0085         CDS       T02156                                 

Gene name
thrC
Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
sie  Streptococcus intermedius JTH08
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:sie00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SCIM_0085 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SCIM_0085 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    SCIM_0085 (thrC)
Enzymes [BR:sie01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     SCIM_0085 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
105866..107350
Genome map
AA seq 494 aa AA seqDB search
MTLVYQSTRDANNTTTASRAILQGLATDGGLFTPISYPQVELDFAKLKDASYQEVAKLIL
SAFLDDFTDQELDDCIAHAYDNKFDTPNIAPLIKLDGQYNLELFHGSTIAFKDMALSILP
HLLTTATKKHGLENKIVILTATSGDTGKAAMAGFADVPGTEIIVFYPKDGVSKVQELQMT
TQTGDNTHVVAIEGNFDDAQTNVKQMFNNAVLRKKLAEHKLQFSSANSMNIGRLVPQIVY
YVYAYAQLVKTDQIRAGEAVNFSVPTGNFGNILAAYYAKQIGLPVGKLICASNENNVLTD
FFKTHIYDKKRCFKVTSSPSMDILVSSNLERLIFHLLGNNSEKTAELMTNLKKHGQYELT
NFDSEMLALFAAEYATEVETAAEIKRVYETSNYIEDPHTAVASAVYQKYRTKTGDDTKTV
VVSTASPYKFPVVAVEAVTGQTGLSDFEALAQLHDLSGVSIPAAVDGIETAEVRHKMIVA
ADQMQAAVEKDLGL
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgactttagtttatcaatcaacgcgtgacgcaaacaatacaacgacagccagccgagct
attttgcagggattggcaacagatggcggtctctttactccaatttcttatcctcaggtc
gagttggattttgcaaaactaaaagatgcttcctatcaagaagtagcaaaattaatttta
tctgctttcttagatgatttcacagatcaagagctagatgattgtattgcccatgcttac
gataacaagtttgatacgccgaacattgctcccttaatcaagctagatggtcagtacaat
ttagagctttttcatggttcgaccattgcttttaaggacatggccttgtccatccttccg
catttattgacgactgcaacgaaaaagcatggtttggaaaataaaattgtcattctgacg
gcgacttctggtgacacgggtaaggcggctatggccggctttgcagacgttcctgggacc
gagattatcgtcttttatccgaaagatggtgtcagcaaggttcaggagctacaaatgaca
actcagacaggggacaatactcatgtagtggctattgaagggaattttgatgatgctcag
accaatgtcaagcagatgtttaataacgctgtgcttcgcaaaaaactagcagaacacaag
ttgcaattttcttccgccaactccatgaatatcgggcgcttggtgccacagattgtttat
tatgtctatgcctatgcacaattggtcaaaaccgatcagattcgagctggtgaagcagtc
aatttttctgttccaactggaaacttcggtaatatcttggcagcctactatgctaaacaa
ataggtcttccagttggcaagttaatctgtgcttccaacgaaaataatgtcttgacagat
ttctttaaaacacatatctatgataagaagcgctgttttaaggtgacatctagcccgtct
atggacattttagtttcttcaaatctagaacgcttgattttccacctgttaggaaataat
tccgaaaagacagcagagttgatgaccaatctcaaaaaacatggtcagtatgagctgacc
aactttgactcagaaatgctagcactctttgcggctgaatatgccacagaagtggagacc
gcagctgaaatcaaacgggtttatgaaacatctaactatattgaagatccgcatacagca
gtagcatcagccgtttatcaaaaatatcggaccaaaacaggtgatgacacgaagacagtc
gttgtttcaactgccagtccttacaaattcccagttgttgcagtcgaagctgtgactgga
caaaccggactgagtgattttgaagctttggctcagttacatgatcttagtggtgtgtca
attccagcagcagtggatggcatcgaaacggctgaagtccgccataaaatgattgttgct
gctgaccagatgcaggcagcagtagaaaaggatttagggctttaa

DBGET integrated database retrieval system