KEGG   Streptococcus intermedius JTH08: SCIM_0085Help
Entry
SCIM_0085         CDS       T02156                                 

Gene name
thrC
Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
sie  Streptococcus intermedius JTH08
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:sie00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SCIM_0085 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SCIM_0085 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    SCIM_0085 (thrC)
Enzymes [BR:sie01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     SCIM_0085 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
105866..107350
Genome map
AA seq 494 aa AA seqDB search
MTLVYQSTRDANNTTTASRAILQGLATDGGLFTPISYPQVELDFAKLKDASYQEVAKLIL
SAFLDDFTDQELDDCIAHAYDNKFDTPNIAPLIKLDGQYNLELFHGSTIAFKDMALSILP
HLLTTATKKHGLENKIVILTATSGDTGKAAMAGFADVPGTEIIVFYPKDGVSKVQELQMT
TQTGDNTHVVAIEGNFDDAQTNVKQMFNNAVLRKKLAEHKLQFSSANSMNIGRLVPQIVY
YVYAYAQLVKTDQIRAGEAVNFSVPTGNFGNILAAYYAKQIGLPVGKLICASNENNVLTD
FFKTHIYDKKRCFKVTSSPSMDILVSSNLERLIFHLLGNNSEKTAELMTNLKKHGQYELT
NFDSEMLALFAAEYATEVETAAEIKRVYETSNYIEDPHTAVASAVYQKYRTKTGDDTKTV
VVSTASPYKFPVVAVEAVTGQTGLSDFEALAQLHDLSGVSIPAAVDGIETAEVRHKMIVA
ADQMQAAVEKDLGL
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgactttagtttatcaatcaacgcgtgacgcaaacaatacaacgacagccagccgagct
attttgcagggattggcaacagatggcggtctctttactccaatttcttatcctcaggtc
gagttggattttgcaaaactaaaagatgcttcctatcaagaagtagcaaaattaatttta
tctgctttcttagatgatttcacagatcaagagctagatgattgtattgcccatgcttac
gataacaagtttgatacgccgaacattgctcccttaatcaagctagatggtcagtacaat
ttagagctttttcatggttcgaccattgcttttaaggacatggccttgtccatccttccg
catttattgacgactgcaacgaaaaagcatggtttggaaaataaaattgtcattctgacg
gcgacttctggtgacacgggtaaggcggctatggccggctttgcagacgttcctgggacc
gagattatcgtcttttatccgaaagatggtgtcagcaaggttcaggagctacaaatgaca
actcagacaggggacaatactcatgtagtggctattgaagggaattttgatgatgctcag
accaatgtcaagcagatgtttaataacgctgtgcttcgcaaaaaactagcagaacacaag
ttgcaattttcttccgccaactccatgaatatcgggcgcttggtgccacagattgtttat
tatgtctatgcctatgcacaattggtcaaaaccgatcagattcgagctggtgaagcagtc
aatttttctgttccaactggaaacttcggtaatatcttggcagcctactatgctaaacaa
ataggtcttccagttggcaagttaatctgtgcttccaacgaaaataatgtcttgacagat
ttctttaaaacacatatctatgataagaagcgctgttttaaggtgacatctagcccgtct
atggacattttagtttcttcaaatctagaacgcttgattttccacctgttaggaaataat
tccgaaaagacagcagagttgatgaccaatctcaaaaaacatggtcagtatgagctgacc
aactttgactcagaaatgctagcactctttgcggctgaatatgccacagaagtggagacc
gcagctgaaatcaaacgggtttatgaaacatctaactatattgaagatccgcatacagca
gtagcatcagccgtttatcaaaaatatcggaccaaaacaggtgatgacacgaagacagtc
gttgtttcaactgccagtccttacaaattcccagttgttgcagtcgaagctgtgactgga
caaaccggactgagtgattttgaagctttggctcagttacatgatcttagtggtgtgtca
attccagcagcagtggatggcatcgaaacggctgaagtccgccataaaatgattgttgct
gctgaccagatgcaggcagcagtagaaaaggatttagggctttaa

DBGET integrated database retrieval system