KEGG   Streptococcus intermedius JTH08: SCIM_0134Help
Entry
SCIM_0134         CDS       T02156                                 

Gene name
glpK
Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
sie  Streptococcus intermedius JTH08
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:sie00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
166859..168370
Genome map
AA seq 503 aa AA seqDB search
MSQETYIMAIDQGTTSSRAIIFNKKGEKVATSQKEFTQIFPQAGWVEHNANEIWNSVQSV
IAGAFIESGIKPNQIEAIGITNQRETTVVWDKKTGLPIYNAIVWQSRQTAPLAEKLKQDG
YVEFFHRKTGLIIDAYFSATKVRWILDQVEGAQERAEQGELLFGTIDTWLVWKLTDGAAH
VTDYSNAARTMLYNIKDLKWDDEILSLLNIPKVMLPEVRSNSEIYGKTVPYHFYGGEVPI
SGMAGDQQAALFGQLAFEPGMVKNTYGTGSFIIMNTGQECNLSKNNLLTTIGYGINGKVT
YALEGSIFIAGSAIQWLRDGLRMISNSPESEKYAKNSTNENEVYIVPAFTGLGAPYWNPE
ARGSVFGLTRGTSKEDFIKATLQSIAYQVRDIIDTMQMDTDTAIQVLKVDGGAAMNDFLM
QFQADILGIELARATNLETTALGATFLAGLAVGYWKDVEELKTLNAVGEIFYPTMLELEC
QKLYEGWKTAVAATQFFAKETSK
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgtcacaagaaacttatatcatggcgattgaccaagggacaactagctcgcgagcgatt
attttcaataaaaaaggtgagaaggttgccacaagtcaaaaagaatttactcaaattttc
ccacaggcaggctgggttgagcacaatgcaaatgagatttggaattctgtacagtcggtt
attgcaggtgcttttattgaaagtggcattaagccaaatcagattgaagcaattggtatt
actaatcagcgggagacaacggttgtttgggataagaaaacaggtttgcctatttataat
gctattgtttggcaatctcgacaaacagctcctttagcagaaaaactcaagcaagatggc
tatgtagagttctttcatcgaaaaacaggtttgattatagatgcttatttctctgcaact
aaggtacgctggattttggatcaagtagagggagctcaggaacgagcagaacaaggggaa
ttgctctttggaacgattgatacatggttggtctggaaattaacggatggtgcagctcat
gtgactgattattccaatgcagcgcggacgatgttgtataatatcaaggatttgaagtgg
gatgatgagattttatctttgctcaatatcccaaaagtcatgttaccagaagttcgttca
aactcagaaatttatggaaaaacagttccctaccatttctatggaggagaagtaccgatt
tcaggaatggcaggcgatcagcaagctgctctctttggtcagttggcatttgagccggga
atggtgaagaatacttatgggacaggctctttcattattatgaatactgggcaggaatgc
aatttatcaaaaaataatcttttgacaaccattggttatgggataaatggcaaagtgact
tatgctttggaagggtcgattttcattgcgggtagtgctattcagtggcttcgtgacggc
ctgcgcatgatttctaattcacctgaatctgaaaaatatgcaaaaaattccaccaatgaa
aatgaagtatatatcgttccagcttttacaggccttggagcaccttattggaatccagaa
gctagaggttctgtttttggtttgacacgtggaacgagtaaagaagattttatcaaagcc
actttgcaatccattgcttatcaggtgcgcgatatcattgatacgatgcaaatggatact
gatacagctatccaagttctaaaggtagatggtggcgctgcaatgaatgattttcttatg
caatttcaagcagatattcttgggattgagttagcacgtgcgacaaatttggaaacaacg
gctcttggagcaacttttctagcggggcttgcggttggctattggaaagatgtggaggag
ctaaaaacattaaatgcggttggggaaatattctatccaactatgctagaactagagtgc
caaaaattatatgaaggctggaaaacagcagttgcagcgacacaattttttgcaaaagaa
actagtaaatag

DBGET integrated database retrieval system