KEGG   Streptococcus intermedius JTH08: SCIM_0134Help
Entry
SCIM_0134         CDS       T02156                                 

Gene name
glpK
Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
sie  Streptococcus intermedius JTH08
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sie00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    SCIM_0134 (glpK)
Enzymes [BR:sie01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     SCIM_0134 (glpK)
Exosome [BR:sie04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SCIM_0134 (glpK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
166859..168370
Genome map
AA seq 503 aa AA seqDB search
MSQETYIMAIDQGTTSSRAIIFNKKGEKVATSQKEFTQIFPQAGWVEHNANEIWNSVQSV
IAGAFIESGIKPNQIEAIGITNQRETTVVWDKKTGLPIYNAIVWQSRQTAPLAEKLKQDG
YVEFFHRKTGLIIDAYFSATKVRWILDQVEGAQERAEQGELLFGTIDTWLVWKLTDGAAH
VTDYSNAARTMLYNIKDLKWDDEILSLLNIPKVMLPEVRSNSEIYGKTVPYHFYGGEVPI
SGMAGDQQAALFGQLAFEPGMVKNTYGTGSFIIMNTGQECNLSKNNLLTTIGYGINGKVT
YALEGSIFIAGSAIQWLRDGLRMISNSPESEKYAKNSTNENEVYIVPAFTGLGAPYWNPE
ARGSVFGLTRGTSKEDFIKATLQSIAYQVRDIIDTMQMDTDTAIQVLKVDGGAAMNDFLM
QFQADILGIELARATNLETTALGATFLAGLAVGYWKDVEELKTLNAVGEIFYPTMLELEC
QKLYEGWKTAVAATQFFAKETSK
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgtcacaagaaacttatatcatggcgattgaccaagggacaactagctcgcgagcgatt
attttcaataaaaaaggtgagaaggttgccacaagtcaaaaagaatttactcaaattttc
ccacaggcaggctgggttgagcacaatgcaaatgagatttggaattctgtacagtcggtt
attgcaggtgcttttattgaaagtggcattaagccaaatcagattgaagcaattggtatt
actaatcagcgggagacaacggttgtttgggataagaaaacaggtttgcctatttataat
gctattgtttggcaatctcgacaaacagctcctttagcagaaaaactcaagcaagatggc
tatgtagagttctttcatcgaaaaacaggtttgattatagatgcttatttctctgcaact
aaggtacgctggattttggatcaagtagagggagctcaggaacgagcagaacaaggggaa
ttgctctttggaacgattgatacatggttggtctggaaattaacggatggtgcagctcat
gtgactgattattccaatgcagcgcggacgatgttgtataatatcaaggatttgaagtgg
gatgatgagattttatctttgctcaatatcccaaaagtcatgttaccagaagttcgttca
aactcagaaatttatggaaaaacagttccctaccatttctatggaggagaagtaccgatt
tcaggaatggcaggcgatcagcaagctgctctctttggtcagttggcatttgagccggga
atggtgaagaatacttatgggacaggctctttcattattatgaatactgggcaggaatgc
aatttatcaaaaaataatcttttgacaaccattggttatgggataaatggcaaagtgact
tatgctttggaagggtcgattttcattgcgggtagtgctattcagtggcttcgtgacggc
ctgcgcatgatttctaattcacctgaatctgaaaaatatgcaaaaaattccaccaatgaa
aatgaagtatatatcgttccagcttttacaggccttggagcaccttattggaatccagaa
gctagaggttctgtttttggtttgacacgtggaacgagtaaagaagattttatcaaagcc
actttgcaatccattgcttatcaggtgcgcgatatcattgatacgatgcaaatggatact
gatacagctatccaagttctaaaggtagatggtggcgctgcaatgaatgattttcttatg
caatttcaagcagatattcttgggattgagttagcacgtgcgacaaatttggaaacaacg
gctcttggagcaacttttctagcggggcttgcggttggctattggaaagatgtggaggag
ctaaaaacattaaatgcggttggggaaatattctatccaactatgctagaactagagtgc
caaaaattatatgaaggctggaaaacagcagttgcagcgacacaattttttgcaaaagaa
actagtaaatag

DBGET integrated database retrieval system