KEGG   Streptococcus intermedius JTH08: SCIM_0191Help
Entry
SCIM_0191         CDS       T02156                                 

Definition
recombinase D
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
sie  Streptococcus intermedius JTH08
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:sie00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    SCIM_0191
Enzymes [BR:sie01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     SCIM_0191
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(224753..227107)
Genome map
AA seq 784 aa AA seqDB search
MEFYFSGTIERIIFENPSSFFRILLLNIDDTDADFDDFEIIVTGTMADIIEGEDYTFWGN
LVQHPKYGEQLKLIRYERAKPTSKGLVKYFSSDHFKGIGVKTAQKIVDLYGDNTIDKVLA
EPEKLHDIVGLSAKNREAFIMKLRQNYGTERVLAKLSEYGISNKLAFQIQDFYKEETLEI
VEHYPYQLVEDIQGIGFKIADQLAQSLGIESTAPERFRAGLLHTLLTQSMEKGDTYLEAK
ELLEHTIELLESSRQIELDPNSVANELAHLIEEDKVQHVDTKIFENSLFFAEERICNNLL
RILEKGNQNKYEPENIEAALAQIEEKFAISYDAIQKQAICDAIQHKIFILTGGPGTGKTT
VINGIIAVYALLHGLDLHKSQDLPILLAAPTGRAARRMNELTGLPSATIHRHLGMTGDDD
TSHLDDYLDADFIIVDEFSMVDTWLANQLLSNISSNSKLLIVGDADQLPSVSPGQVLADL
LKIPLLPQTKLEKIYRQGEDSTIVTLASQIQKGTLPIDFIEKKADRSYFEVRSEQIPQMI
ERIVEVAIRSGIPAQDVQVLAPMYRGQAGIDHINQLMQDLINPVVKEQLIFEATDGQYRQ
GDRVIHLVNDAESNVFNGDLGYITDLLPAKYADSKQDELTINFDGNEIVYQRSEWYKIRL
AYAMSIHKSQGSEFPVVILPITSSSHRMLQRNLIYTAITRAKSKLILLGEKSAFAFAVQN
TGTTRKTYLLQRFANLPTDEKIMHTSMDDLKTSVEDYVLTEENFSKINPMIGLTEEDIHS
IFGN
NT seq 2355 nt NT seq  +upstreamnt  +downstreamnt
atggaattttacttttcaggtaccatcgaacgcattatctttgaaaatcccagcagtttt
ttccggattctgttgctaaatattgacgacaccgatgcggattttgatgattttgagatt
attgtcaccggcactatggcagatattatagagggggaagactataccttctggggaaat
ctcgtgcaacaccctaaatatggtgaacagctcaaactaatacgctatgagcgtgctaaa
ccaaccagcaaaggcttggtcaaatatttttcaagcgaccattttaaaggaatcggtgta
aaaacagcacaaaaaattgtggatctctacggcgataacacgattgataaggtcttggca
gaacccgaaaaattacatgatattgtaggcctttctgctaaaaatcgcgaagcctttatt
atgaaattaagacagaactacggtaccgagcgagtccttgcaaagctatctgagtacggc
atttcaaataaacttgcctttcagattcaagatttttacaaagaagagactctcgaaatt
gtcgaacactatccttatcaattagtggaagatattcaaggaataggatttaaaattgcc
gaccaactggcgcaaagcttaggaattgaaagtactgctccagagcgcttccgtgcagga
ttactccacacacttctaacccagtccatggaaaaaggcgacacctatcttgaagcaaaa
gagcttctggaacacaccattgaacttctggaaagctcccgacagatcgaactagatcca
aattccgttgcaaatgagctagctcatttgattgaagaagataaagtccaacatgtcgat
acgaagatttttgaaaacagtctcttttttgctgaagaaagaatttgcaacaatctctta
cgcattctggagaagggaaatcaaaataaatatgaaccagaaaacatcgaagctgcgctt
gctcaaatcgaagaaaaatttgctatttcttacgatgcgattcagaagcaagctatttgc
gatgctatccagcataaaattttcatcttaacaggtggtcctggaactggaaaaacgact
gttatcaatggaattattgctgtctacgcgctgctacatggtctggatttacacaaatct
caagatttacctatccttttagccgctccaactgggcgtgctgctagacgcatgaatgaa
ttaacaggactgccaagtgcgacgattcatcggcatttaggcatgacaggagacgatgac
accagtcatttagacgattatttggacgcagattttattattgtggacgaattttcaatg
gtagatacttggttagccaatcaactactcagcaatatctcttccaatagcaagctactc
attgtcggagatgccgaccagctaccctctgtcagtcctggacaagtgttagcagatttg
ctgaaaatccccctccttccacagaccaaattagaaaaaatttatcggcagggcgaagat
tccacgatcgttaccttagctagtcagattcaaaaaggcactctgccaattgatttcatt
gaaaaaaaagcagatcgttcttattttgaagttcgtagcgagcagattccacagatgatt
gaacgcattgtggaagtcgctatccgtagtggtattccagctcaagatgtacaagtactt
gctcctatgtaccgtggacaagcaggaattgaccacatcaatcaactcatgcaagatctg
atcaatcctgttgtaaaagaacaacttatctttgaagctactgatggtcaataccgacaa
ggtgatcgggttattcatctcgtcaacgatgctgaaagcaatgtgttcaacggtgatttg
ggttatatcaccgatttactaccagcaaaatatgctgattccaagcaagatgaactgact
atcaatttcgacggcaatgagattgtttatcaacgcagtgaatggtacaagattcgtctg
gcatacgctatgagtatccacaaatctcagggcagtgaatttccagtcgtcattttaccg
attacgtctagcagccaccgcatgctgcaacgcaatcttatctatactgctatcacccgc
gccaagagcaaattgattcttcttggggaaaagtctgcctttgcctttgctgtccaaaat
actgggacaacacgtaaaacctatctccttcaacgttttgcaaatctaccaacagatgaa
aaaataatgcacacttctatggatgatttgaaaacaagcgtggaagactatgtcttgact
gaagaaaatttttcgaaaataaatcctatgatcggactgactgaagaagatatccacagt
atctttggcaactaa

DBGET integrated database retrieval system