KEGG   Streptococcus intermedius JTH08: SCIM_0289Help
Entry
SCIM_0289         CDS       T02156                                 

Gene name
adh
Definition
alcohol dehydrogenase
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
sie  Streptococcus intermedius JTH08
Pathway
Glycolysis / Gluconeogenesis
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Class
Metabolism; Overview; Degradation of aromatic compounds [PATH:sie01220]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:sie00010]
Metabolism; Lipid metabolism; Fatty acid degradation
Metabolism; Amino acid metabolism; Tyrosine metabolism
Metabolism; Xenobiotics biodegradation and metabolism; Chloroalkane and chloroalkene degradation [PATH:sie00625]
Metabolism; Xenobiotics biodegradation and metabolism; Naphthalene degradation [PATH:sie00626]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(334524..335546)
Genome map
AA seq 340 aa AA seqDB search
MKAVVVNPAGTSVEIVENKELRPLETGEALVEIEYCGVCHTDLHVAHGDFGKVPGRVLGH
EGIGIVKELAPDVTSLKVGDRVSVAWFFEGCGVCEYCTTGRETLCRTVKNAGYSVDGGMA
EQCIVTADYAVKVPEGLDPAQASSITCAGVTTYKAIKEAKVEPGQWVVMYGAGGLGNLAV
QYAKKVFNAHVIAVDINNDKLELAKQVGADIVINGHEVEDVPGLIKEKTNGGAHSAVVTA
VSKVAFNQAVDSVRAGGRVVAVGLPSEMMDLSIVKTVLDGIQVIGSLVGTRKDLEEAFQF
GAEGLVVPVVQKRPVEDAVDIFDEMEAGTIQGRMVLDFTH
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagttgttgttaatccagcaggcactagtgtcgaaatcgttgaaaacaaggaa
ctacgtccccttgaaacaggcgaagcactcgttgagattgaatattgtggtgtctgccat
actgaccttcacgtagcacatggtgatttcggaaaagttccaggacgtgttcttggtcac
gaaggaatcggcattgtcaaagaattagcacctgatgtgacaagcttaaaagttggcgat
cgtgtcagcgtcgcttggttctttgaaggctgtggtgtttgtgaatactgtaccactgga
cgtgaaacactttgtcggactgtaaaaaatgcaggctactccgttgatggaggtatggcc
gaacaatgtatcgtcacagctgattatgctgttaaagttcctgaaggattagatcctgcg
caagcttcttctatcacttgtgctggtgttaccacttacaaagctatcaaggaagcaaaa
gttgaaccagggcaatgggttgtcatgtacggtgcaggaggtcttggtaacctcgctgta
caatacgctaaaaaagtcttcaatgctcatgtcattgctgttgacatcaacaatgacaaa
cttgagttggctaaacaagtcggagcagatatcgttatcaatggtcacgaagtagaagat
gttccaggattaattaaagaaaagacaaacggtggagctcattcagctgtcgtaacagct
gtttcaaaagtcgcttttaaccaagccgttgattctgtacgtgcaggtgggcgtgtagta
gccgttggacttccctcagaaatgatggatctcagtattgtgaaaactgtacttgatggc
attcaagtcatcggctctttagttggtacccgtaaagatttagaagaagcattccaattt
ggtgctgaaggtctggtcgtaccagttgtccaaaaacgccctgtagaagatgccgtagat
atctttgatgaaatggaagccggaacgattcaaggtcggatggttcttgattttactcac
tga

DBGET integrated database retrieval system