KEGG   Streptococcus intermedius JTH08: SCIM_0605Help
Entry
SCIM_0605         CDS       T02156                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
sie  Streptococcus intermedius JTH08
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sie00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SCIM_0605 (tpiA)
   01230 Biosynthesis of amino acids
    SCIM_0605 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SCIM_0605 (tpiA)
   00051 Fructose and mannose metabolism
    SCIM_0605 (tpiA)
   00562 Inositol phosphate metabolism
    SCIM_0605 (tpiA)
Enzymes [BR:sie01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     SCIM_0605 (tpiA)
Exosome [BR:sie04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   SCIM_0605 (tpiA)
  Exosomal proteins of bladder cancer cells
   SCIM_0605 (tpiA)
  Exosomal proteins of melanoma cells
   SCIM_0605 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
706213..706971
Genome map
AA seq 252 aa AA seqDB search
MSRKPFIAGNWKMNKNPEEAKAFVEAVASKLPSSELVEAGIAAPALDLSTVLAAAKGSNL
KIAAENCYFEDAGAFTGENSPKVLAEMGTDYVVIGHSERREYFHETDEDINKKAKAIFAN
GMLPIICCGETLETYEAGKAAEFVGGQVSAALAGLSEEQVSSLVIAYEPIWAIGTGKSAS
QDDAQKMCKVVRDTVAADFGQAVADKVRVQYGGSVKPNNVAEYMACPDVDGALVGGASLE
AESFLALLDFVK
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgtcacgtaaaccatttatcgctggtaactggaaaatgaacaaaaatccagaagaagct
aaagcatttgttgaagcagtagcttctaaattgccttcatcagaacttgttgaagctggt
atcgcagctccagctcttgacttgtcaacagttcttgcagctgctaagggttctaatctt
aaaattgccgcagaaaactgctattttgaagatgctggtgctttcactggtgaaaacagc
cctaaagtgttggctgaaatgggcacagattacgttgtaattggtcactcagaacgtcgt
gaatacttccatgagacagatgaagatatcaataaaaaagcaaaagcaatctttgcaaat
ggtatgcttccaattatttgttgtggtgaaacacttgaaacttatgaagcaggtaaagcc
gctgaattcgtaggtggacaagtttcagccgctcttgctggcttatcagaagaacaggtt
tcttcacttgttatcgcatatgaaccaatctgggctattggtactggtaaatcagctagc
caagatgatgcacaaaaaatgtgtaaagttgttcgtgacacagttgcagcagattttggc
caagcagtagcggataaagttcgtgtacaatacggcggctcagtaaaacctaacaatgtt
gctgaatacatggcttgtccagatgttgatggcgctcttgttggtggtgcatcacttgaa
gcagaaagtttccttgcgttattagactttgtgaaataa

DBGET integrated database retrieval system